CAZyme Information: MGYG000001904_00203

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-917
• CAZyme ID: MGYG000001904_00203
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36960.62	9.4845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001904	1027898	MAG	Denmark	Europe

• Gene Location: Start: 6485; End: 7441 Strand: -

Full Sequence      

MRKFSVMEDKHGKKRLALNNKIYFQSGVLDQGYWSDGMLTPPTDSAMEYDIKLMKDMGFN
MLRKHIKIEPLRWYYHCDRLGMIVWQDFVTGGRKYKFSVIGIGGFLNLPTKDTKRNYKKF
ARQDEEGRAEYYSEMETEINYLKNCVSLGTWVPFNEGWGQFDSKIATEKVRALDPTRIID
SVSGWYDQGVGNTDMKSLHIYFTPIKCPKDPRVCVLSEFGGYSYKERPHVFSPNKSFGYR
IYGTAAKLEKGFKKLYEKSIVKNVKKGFSATVYTQVSDVEEEINGFITYDRKVVKIPVKT
VVECNEMLKKCYRELLGE

Enzyme Prediction     

No EC number prediction in MGYG000001904_00203.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.28e-09	35	88	310	364	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.63e-04	47	220	38	211	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	0.003	43	84	369	410	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABZ98834.1	8.18e-118	1	309	254	560
ABZ95154.1	8.18e-118	1	309	254	560
AEC02401.1	8.38e-111	1	309	286	591
AIY03364.1	3.43e-110	1	308	278	584
ACZ86262.1	3.57e-110	1	309	275	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.89e-69	2	305	291	579	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001904_00203.