CAZyme Information: MGYG000001907_00602

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1242; UMGS1908
• CAZyme ID: MGYG000001907_00602
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
176		20304.5	6.9259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001907	852223	MAG	Denmark	Europe

• Gene Location: Start: 7347; End: 7877 Strand: +

Full Sequence      

MKKNCRIVVWVLIGIVSGLATLTAYVKLFFPVDYMPIIKKYGKEYEVDVSLVLAIINTES
RFDKSAVSKKGAVGLMQLMPTTAEFVASTLGEAFDKKSLFNEETNIKYGIYYLHYLFCKY
NEVNDVLFCYNAGEGVYLNFINENNGTFDKDKIEIKETQNYINKVNRDRQVYEYLI

Enzyme Prediction     

No EC number prediction in MGYG000001907_00602.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	49	167	9.1e-23	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.78e-46	31	171	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.81e-40	30	175	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	5.99e-31	10	175	115	286	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	4.81e-30	50	170	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	1.64e-27	36	176	1	142	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDM68683.1	9.16e-32	1	175	1	179
AIY84028.1	3.56e-31	3	175	2	178
AQM60520.1	4.00e-30	3	175	2	178
SHD77963.1	5.93e-29	1	175	5	184
QCX32506.1	8.73e-28	27	175	26	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	8.62e-11	30	176	449	602	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.59e-10	30	176	449	602	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6CF9_A	2.81e-10	27	176	344	500	Crystalstructure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni at 2.3A resolution in I23 space group [Campylobacter jejuni],6CFC_A Crystal structure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni in complex with Bulgecin A [Campylobacter jejuni]
6CF8_A	2.81e-10	27	176	344	500	Crystalstructure of Cj0843 lytic transglycosylase of Campylobacter jejuni at 1.87A resolution [Campylobacter jejuni]
7LAM_A	2.84e-10	27	176	364	520	ChainA, Lytic transglycosylase domain-containing protein [Campylobacter jejuni],7LAQ_A Chain A, Lytic transglycosylase domain-containing protein [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9CLB8	2.00e-12	34	167	190	329	Membrane-bound lytic murein transglycosylase C OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltC PE=3 SV=2
Q7VKB7	2.06e-12	34	172	199	363	Membrane-bound lytic murein transglycosylase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=mltC PE=3 SV=1
Q0I513	5.16e-12	34	175	188	329	Membrane-bound lytic murein transglycosylase C OS=Haemophilus somnus (strain 129Pt) OX=205914 GN=mltC PE=3 SV=1
B0UWE6	5.16e-12	34	175	188	329	Membrane-bound lytic murein transglycosylase C OS=Histophilus somni (strain 2336) OX=228400 GN=mltC PE=3 SV=1
B3GYW8	1.79e-11	3	175	173	364	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.975879	0.022944	0.000588	0.000068	0.000040	0.000514

TMHMM  Annotations     

start	end
7	29