CAZyme Information: MGYG000001908_00243

Basic Information

• Species: Ruminococcus_D sp900543145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp900543145
• CAZyme ID: MGYG000001908_00243
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		42846.71	4.33

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001908	2355088	MAG	Denmark	Europe

• Gene Location: Start: 281851; End: 283008 Strand: +

Full Sequence      

MKIKKTLALILGTAIAVSGFAACSDKDGEKDSESGTSQTEETPKEIRDITSWNLVKEMKT
GWNLGNTMDATGGSGVDAETSWGNKETSKAMVDLLKSSGFNVLRVPVSWGTHMDDEYNVD
EAWMTRVKEIVDYGIDNDMFVILNTHHEDWYFPTEENKEEDIKQLKALWTQIADEFKNYD
EHLIFEGLNEPRLRNTPGEWTGGDSASRAIVNEYAKAFYETVRNSGGNNPKRHLMITGYA
ASSSRNCLEAIDLSGFDDKVIVSVHAYLPYSFALDTKGTDVFNAEADGSSIDNLFIDLND
LFLSKNIPVIVGEYGSVNKYNIEDRVECAKYYLNTAKKAGVPCIWWDNGATAGAGENFGL
MDRSLPPAWNFQEIIDAIMSVYSES

Enzyme Prediction     

EC	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	79	349	3.3e-96	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.23e-70	68	350	1	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.01e-36	53	350	46	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO06082.1	1.23e-171	1	378	1	378
ADU20585.1	1.21e-140	1	384	1	399
CAA38693.1	2.69e-140	1	385	1	402
AAA26469.1	4.24e-136	53	384	71	399
ADK66823.1	1.40e-127	38	379	20	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQP_A	8.81e-109	41	379	6	353	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6Q1I_A	9.72e-109	54	382	17	353	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6PZ7_A	5.67e-105	48	380	6	335	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
3AYR_A	3.91e-102	46	363	15	342	GH5endoglucanase EglA from a ruminal fungus [Piromyces rhizinflatus]
3AYS_A	3.14e-101	46	363	15	342	GH5endoglucanase from a ruminal fungus in complex with cellotriose [Piromyces rhizinflatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23661	5.37e-141	1	385	1	402	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P16216	8.48e-137	53	384	71	399	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1
P54937	9.34e-107	54	382	42	378	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23660	3.33e-100	45	379	21	360	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	1.56e-98	46	379	38	369	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000006	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001908_00243.