CAZyme Information: MGYG000001908_01669

Basic Information

• Species: Ruminococcus_D sp900543145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp900543145
• CAZyme ID: MGYG000001908_01669
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		64797.86	8.5623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001908	2355088	MAG	Denmark	Europe

• Gene Location: Start: 78443; End: 80209 Strand: -

Full Sequence      

MTFNKYFFAVAAVFVISILSSFFTVSAAQTGKCTADALNIRSGAGTSYSKTGMLYYGDTV
TVESTVKGSDGSEWYKISYSKSGSKKSGYVSSEYISVSGSQQVGSSDKDFESYLDKQGFP
ESYKPALRELHSKYPNWVFTAQQLEMTWDKALKEENVLGRNLVHSSALASWKSMEKGAYD
FENNKWYGLDGSWVAASKEIIAYYMDPRNFLDDTYIFMFENLSYNKDIHNIGGVKAILSD
TFMSGSYTCPDTKKTYSYAQTFMDAAEKSGVSPYHLASRCRNEQGVNGAPQSLGTVKGYE
NYFNFFDIQAYATSTMTAAEMGCKYAKTKNPTYLLPWTNQYKSIIGGSVFLGTGYITKEQ
DTLYLQKFDVVDGGNGYYYHQYMTCVFGQANEAVSLKNAYSDDVLNSKLEFKIPVYKEMP
DTVFTKPVSSGDNNNLLKSLSISGQKVTPSFDKYTQSYKLTVDNNISSVTVNATALSKKA
KISGTGNKSLKIGKNTLNINVTAASGAVRTYKITVTRKEASKGLQLGDVDGDKSITVVDA
LTVLKYNAGSIDLTAEQKKRADVDSNGKADVVDALIILKYVSGKITEF

Enzyme Prediction     

No EC number prediction in MGYG000001908_01669.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	9.30e-16	186	417	41	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
cd14256	Dockerin_I	2.23e-15	526	581	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	5.11e-10	527	581	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
pfam12733	Cadherin-like	9.91e-09	447	517	6	88	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
cd14253	Dockerin	8.83e-08	527	580	1	54	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04280.1	1.30e-281	8	557	12	554
ADU22837.1	6.08e-172	24	546	29	529
ACR71571.1	9.51e-117	71	519	85	530
CBK77705.1	1.43e-116	27	518	39	630
QRV21758.1	1.86e-115	35	518	45	608

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39848	2.70e-09	165	417	651	880	Beta-N-acetylglucosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lytD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000385	0.998780	0.000319	0.000171	0.000155	0.000157

TMHMM  Annotations     

start	end
7	29