CAZyme Information: MGYG000001910_00114

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_00114
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000001910_1|CGC2	46122.16	7.3887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 127674; End: 128879 Strand: +

Full Sequence      

MYICDTKFTFNHNHHISNIMKRLVKTAFIALICNFIVNDAMAAPKRDYELRRTDKEFFTT
PEAARIGEQVLAYQRVTGGWPKNIDMCRPHTPEELAEIKTQRDRRNDSTTDNNATTTQMT
FLARLYQATGDTRYRDAFLAGMEYLLSGQYPNGGWPQFWPDPQGYQIHITFNDGAMANTL
TLLRDIFEQHEPYGGNLTDETLRTRLRVAFEKGIDCILATQIRVDGKPTVWCQQHDRETF
APAPARSYELPSFCSAESSQIVGLLMQLPAPDKRIKEAVHGAMAWFEANKLMGYRLERTG
RPKSPESDTRLVANPAAGPLWGRFYDLEKCEIYVCDRDGIPRKSLEEIGHERRNGYSWYN
DNPLSLYPVYDKWADLNDPDGKVRIDMSLVNKAEARSQKRR

Enzyme Prediction     

No EC number prediction in MGYG000001910_00114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	74	365	2.3e-114	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	3.33e-153	74	366	1	288	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.18e-120	74	366	1	289	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41704.1	7.48e-290	20	401	1	382
ALJ61703.1	1.48e-152	21	388	9	374
ALK83448.1	5.00e-152	20	388	1	380
QUT92735.1	6.47e-152	21	388	9	374
QUT60181.1	7.07e-152	20	388	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.59e-59	57	373	77	404	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	2.32e-55	60	366	30	322	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	3.52e-54	60	366	30	322	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.026971	0.968390	0.003900	0.000283	0.000225	0.000212

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001910_00114.