CAZyme Information: MGYG000001910_00367

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_00367
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37162.18	6.5162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 51066; End: 52052 Strand: -

Full Sequence      

MNNYHKSFIGSVAVLAALAFFAPAEDVQALTPAEEAPEVENAQDYSEVINPRIPKSVKFA
GQKVDLDRTDRWERLDRELTAMTYTHGNTLLAIKRANRYFPVLAPILKKNGIPSDLIYLA
VIESTLNPRALSPAKAGGLWQFMPSTAKEYGLEVNDYVDERYDPVKATEAACDYLKKSYA
KYGNWESVAASYNGGVARITNELAAQQVDTAYDLYLADETMRYMFRLLAMKLIMENPQDY
GFRISSDQLYQPLEYKTVEVSGPVEDWPTWAKAQGIDYMTLRENNPWIRAKSLPNKTGKT
YTVKIPTKDSMSRARQKKSVYNQAWVTD

Enzyme Prediction     

No EC number prediction in MGYG000001910_00367.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	100	231	4.9e-22	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.90e-61	107	231	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.03e-27	108	199	6	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	1.32e-24	83	265	92	273	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	1.69e-15	115	195	2	81	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.82e-14	99	195	6	107	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43280.1	4.91e-240	1	328	1	328
QCP73626.1	2.01e-175	1	326	1	326
QCD39978.1	2.01e-175	1	326	1	326
ASB38769.1	2.01e-152	35	328	25	321
QQR09511.1	2.01e-152	35	328	25	321

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.63e-24	63	308	68	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.63e-24	63	308	68	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	2.70e-11	89	204	15	131	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999036	0.000190	0.000180	0.000164	0.000140

TMHMM  Annotations     

start	end
7	24