CAZyme Information: MGYG000001910_00485

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_00485
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000001910_4|CGC1	34732.93	6.4072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 47024; End: 47959 Strand: +

Full Sequence      

MLLPAAMGLKVSAAEYKHDIYVNQDGSGDYTTITEALEGIRAYMDYTVTVHIANGTYKEK
IIIPSWLKNVSFIGEDPEKTVITFDHHANIDKMGTFRTYTVRVDANDVLFKNLTIENNAP
QLGQAVALHTEGDKIRFVNCRFLGNQDTIFTGGKNARLYFADCYIEGTTDFIFGPATAYF
KNCDIFSKRDSYITAASTPGDVRFGYIFDSCKLRAADNVKKVYLGRPWRPYAHTVFINCE
MGSHIRPEGWHNWNNADNERTARYGEYGSHGPGAAQSGRVGWAMNITDAGAAAYRSLTEI
FSVTSGWDPTE

Enzyme Prediction     

No EC number prediction in MGYG000001910_00485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	20	294	2.7e-100	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	7.96e-77	22	294	9	290	pectinesterase
pfam01095	Pectinesterase	9.25e-74	19	283	1	275	Pectinesterase.
PLN02665	PLN02665	4.28e-64	20	300	70	354	pectinesterase family protein
PLN02432	PLN02432	9.76e-64	20	307	13	291	putative pectinesterase
PLN02682	PLN02682	1.15e-63	20	300	71	361	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41442.1	3.28e-216	1	311	11	321
QCD38272.1	2.25e-170	1	311	10	320
QCP71960.1	2.25e-170	1	311	10	320
QDO69178.1	2.12e-138	15	311	26	322
ALJ61263.1	5.58e-129	1	309	13	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	4.98e-37	28	250	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.68e-36	28	250	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	4.17e-36	19	282	8	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.18e-33	22	282	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	4.46e-23	13	250	1	279	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.75e-51	20	299	7	297	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GX86	6.32e-47	9	283	243	529	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q3E8Z8	1.51e-42	9	282	242	525	Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana OX=3702 GN=PME28 PE=2 SV=1
Q9LXD9	1.02e-41	17	294	238	535	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q8GXA1	1.26e-41	17	282	255	531	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001910_00485.