CAZyme Information: MGYG000001910_00712

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_00712
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000001910_6|CGC1	58927.23	7.8458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 49372; End: 50994 Strand: +

Full Sequence      

MKKTAVLVLAAMATMDIAAQYPTIPDSIKARAARQEAEWDAHSDKAWAEAYPIVMKEEAE
NGRPYRPWASKPEDLIKADIVAFPGAEGGGAYTPGGRSGKVYVVTSLADSGPGTLREACE
KGGARTIVFNVAGVIKLNSPITVRAPYITILGQTAPGDGVCVTGASFLIDTHDVIIRHMR
FRRGAQDVAFRDDALGGNAVGNIIIDHVSGSWGLDENMSIYRHVYNRNPETGKGEKLPTV
NITIQNSIFSEALDLYNHAFGATIGGHNSTFARNLFASNISRNCSIGMDEDFNFINNVTY
NWWNRSVDGGDHTSRLNIINNNFKPGPITETNSANAPIRYRIVKMEAGRDKAFKDKFGKA
YVSGNKVWGNDKVTADNWAGGVQIYNGPVPAERIAELKADAPFPMADVTIMETAPAYEYV
LKNAGATKPKRDAVDVRVIKTVKTGKAIYEKDADKYTSSTPYVKRRLPSDSYKNGIITDP
RQVGGLPEYKGKPRVDNDNDGLPDAWEKKHGLNPNDPTDSAKDSGNGYTWIEVYANELAK

Enzyme Prediction     

No EC number prediction in MGYG000001910_00712.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	132	323	9.3e-62	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	1.41e-04	147	302	17	166	Amb_all domain.
pfam18884	TSP3_bac	1.91e-04	496	517	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR68105.1	4.95e-278	15	538	18	535
QJR55559.1	4.95e-278	15	538	18	535
AII69027.1	4.95e-278	15	538	18	535
ALA74794.1	4.95e-278	15	538	18	535
AII63047.1	4.95e-278	15	538	18	535

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	1.04e-51	80	538	20	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
A1DPF0	1.07e-51	80	538	21	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B0XMA2	4.00e-51	80	538	21	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	7.74e-51	80	538	21	414	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q2UB83	7.61e-50	80	538	20	413	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000396	0.998905	0.000189	0.000182	0.000163	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001910_00712.