CAZyme Information: MGYG000001910_00895

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_00895
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000001910_8|CGC2	43537.46	9.2539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 18286; End: 19473 Strand: +

Full Sequence      

MKYFFSAGEASGDLHAAQVIKELLKLDPEADICFLGGDRMADASGRAPLIHFSRMAFMGF
IDVARHLPEVLGNLRTAKEAIRTQRPDAVVLVDYPGFNLKLAKYAKGLGIKVFYYIAPKL
WAWKSYRIKQIRRYVDEVFSILPFEPAWFSERGVEVTYVGNPSVEEVEDAIRALPSRGEF
FAAHGLADRPVLALVPGSRVGEIKANLPVMDAVARRHPGLQAVVAGAPSLSREFYARFTD
LPVVDGATLGLMANSRVAMVTSGTAALECALAGCPQVVCYRAVGWKWAHDIFLHILKIPY
ASLPNLVGGKIDRLTRDEVNREAVRTGVRGCVVPEMLVHNCTPEMVDRQLAPLIGDTSER
RAQLDGYDRVRRILHTDSSAAANVAALIRRSLGRR

Enzyme Prediction     

No EC number prediction in MGYG000001910_00895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	374	2e-101	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.71e-117	1	391	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.18e-99	1	380	2	368	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.65e-77	4	388	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.27e-59	6	387	11	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.54e-50	1	306	2	285	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP71596.1	1.75e-225	1	392	1	392
QCD40491.1	1.75e-225	1	392	1	392
QCD41269.1	5.21e-162	1	231	1	231
QCD36425.1	4.41e-133	1	388	1	370
QQR08529.1	8.54e-127	1	395	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.83e-38	7	387	13	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.90e-37	7	387	13	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	9.27e-61	7	387	11	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	7.15e-60	7	374	15	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	2.79e-59	7	374	15	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	2.79e-59	7	374	15	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q02AZ6	1.45e-58	2	392	3	373	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000088	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001910_00895.