CAZyme Information: MGYG000001910_01443

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_01443
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		35503.87	5.8246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 18376; End: 19338 Strand: -

Full Sequence      

MLRKSLSLLMLLVSIVSAYATERKYDFVVAQDGSGDFTTIQEAINAVPDFRKANRTNILI
KKGSYKEKLIIPECKINLTLTGEDGAVITYDDYASKPNRFGEEKSTSGSASCYIYAPDFI
AENLTFENSSGPVGQAVACFVSGDRAIFRKCRFLGCQDTLYTYGYPTRQYYEDCYIEGTV
DFIFGKATAVFNRCQIHSRGKGYVTAPATPEDSKYGYVFHDCKLTAENGVTNVPLSRPWR
PYAQAIFINCELGKHISPAGWNNWGKESNEKTVTYAEYNSTGEGANPSARVSYSRQLSDP
TPYAITTVLAGEDGWNPLEL

Enzyme Prediction     

No EC number prediction in MGYG000001910_01443.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	299	9e-104	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	2.65e-80	29	299	9	284	pectinesterase
pfam01095	Pectinesterase	3.12e-78	26	294	1	275	Pectinesterase.
PLN02682	PLN02682	1.70e-74	25	299	69	349	pectinesterase family protein
PLN02432	PLN02432	1.04e-69	29	315	15	291	putative pectinesterase
COG4677	PemB	1.84e-67	26	311	81	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41759.1	1.52e-239	1	320	1	320
ALJ61265.1	3.64e-165	23	319	282	578
QUT93206.1	3.64e-165	23	319	282	578
QGT74299.1	2.96e-163	23	318	235	530
QIU94488.1	5.85e-162	23	319	273	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	9.75e-47	28	311	6	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.80e-43	28	293	10	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	3.19e-37	35	298	17	278	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	1.59e-36	25	299	4	322	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	1.71e-36	35	298	17	278	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.82e-60	29	299	9	284	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	7.88e-57	31	313	90	379	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	2.99e-50	28	295	274	550	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9FM79	4.66e-50	20	298	75	359	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q42608	4.75e-50	28	295	261	537	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998927	0.000214	0.000168	0.000161	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001910_01443.