CAZyme Information: MGYG000001910_02631

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_02631
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177		20114.15	10.1861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 6365; End: 6898 Strand: -

Full Sequence      

MHKRKVYNADNKNDSTPPQISSIPETAIGVKNMPQTLSASIVTTSKSHSRQAPVSSGLPD
LTIPNLIIEIEKNGIKYPKIVLAQAILETGWFKSPVCRNKHNLFGLTNPRTGKYYEFSHW
TESVRAYYSKVQYRYMGGNYLLWLKKIGYAEDPGYIRAVIRVVRQLHSDKNLEGLVF

Enzyme Prediction     

No EC number prediction in MGYG000001910_02631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	68	165	1.2e-17	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.37e-16	64	141	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	1.22e-13	71	170	59	186	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	8.69e-11	67	165	20	138	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.86e-07	82	165	186	305	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	1.13e-05	15	169	123	300	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35499.1	1.30e-105	1	166	41	206
QCD43688.1	5.34e-70	46	166	65	185
QCD34777.1	1.91e-66	44	166	84	200
ANU62956.1	1.03e-65	44	166	82	198
QQR09706.1	1.03e-65	44	166	82	198

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999645	0.000389	0.000004	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001910_02631.