CAZyme Information: MGYG000001912_00511

Basic Information

• Species: UMGS1839 sp900555545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1839; UMGS1839 sp900555545
• CAZyme ID: MGYG000001912_00511
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		41925.51	7.3671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001912	1976012	MAG	Denmark	Europe

• Gene Location: Start: 4795; End: 5859 Strand: -

Full Sequence      

MLFRKKKPYPEHEYPHMQQPSLEPNDYQKEQMARRFGMFIHFGINTFNNTEWSNGRLPIR
SYRPTAVEADSWVRTAYEAGMNYVILITKHHDGFCLWDTHTTKYSVNYSPNPTDVVRAVS
EACRKYGIKLGLYYSLWDRHERCYRNNEKYVAYMERQLTELLDGRYGEVVELWFDGAWDK
PCRAWQLDRLYNLVKTLQPCCQIGVNHTVGEYPEKKGGPDPRYQPQNYQDRDPLRMFPSD
FRLWDPHMCREDDPKIYTFNGKEYYLPFEMTICSRQEFSWFYSDTYAAKPLMDAEEIIRN
YRILEKNGNMLVINLPPDYNGRLVPGDVDNLMRVARALGIQRGWNAPAVDGCKS

Enzyme Prediction     

No EC number prediction in MGYG000001912_00511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	17	336	2.3e-65	0.8815028901734104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.19e-41	35	353	27	341	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.71e-39	35	331	26	321	Alpha-L-fucosidase.
COG3669	AfuC	8.53e-33	24	343	11	317	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOD60739.1	2.49e-109	28	345	35	345
QBN20382.1	6.86e-108	23	343	25	338
QIU93293.1	7.74e-103	20	354	25	356
QEW36132.1	5.82e-102	22	347	21	347
AOW08576.1	1.23e-101	17	347	23	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	4.69e-42	22	335	30	349	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	1.40e-37	21	338	16	347	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	3.59e-36	21	338	16	347	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	4.89e-35	21	338	18	349	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	1.78e-33	24	327	39	341	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	2.21e-37	7	328	28	330	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	5.67e-34	20	331	40	334	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q9VTJ4	2.55e-12	35	192	54	249	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
P17164	2.47e-10	20	340	38	360	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
P10901	1.04e-09	35	340	41	355	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000006	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001912_00511.