CAZyme Information: MGYG000001912_00512

Basic Information

• Species: UMGS1839 sp900555545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1839; UMGS1839 sp900555545
• CAZyme ID: MGYG000001912_00512
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495		56567.03	6.3403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001912	1976012	MAG	Denmark	Europe

• Gene Location: Start: 5950; End: 7437 Strand: -

Full Sequence      

MDAVQGNLAILKSSTCLRMEDGTFYGWEGVSRQDGSCEGTCQHVWNYAYALPFLFPELER
SVRETELDYNLEKSGRTHFRSTIPFGRRQFFRACVDGQMGTVMKFYREWKISGDSEWLRR
YWPRIQSCIAYAWSSRNADRWDPDKTGVIHGRQHHTLDMELFGANSWLTGFYHGALLAGA
EMAEAMGDHGSAREYRALYEKGHRWVEEHLFDGEHYVQEIDLQSDRALAKYGKSCRNTYW
DPVLGQIKYQLGSGCEVDQVTADWHAGLMGLPPVFDPDHRKRALQSIYHNNFRSMREVFN
PCRVFACDGESGVMMCTWQDGKVKPKIPIPYTEECMTGFEYAVACGMLQCGMEREALEIV
SAIRSRYDGKKRNPWAEIECGASYARAMASYSLLLAYSGFCYDLTQGMVGFRPIHPGRYF
WSIGTAWGMASWEEEGLRVEILYGSLTLKRMVHPLRRVEYVLLGTSEVPFSQEGDAVAFQ
VSLSSGDVLFIGESR

Enzyme Prediction     

No EC number prediction in MGYG000001912_00512.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	93	393	7.2e-60	0.7327823691460055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04685	DUF608	1.90e-37	44	393	19	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	5.54e-19	2	400	324	720	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam00723	Glyco_hydro_15	1.07e-04	121	214	148	227	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
pfam17389	Bac_rhamnosid6H	0.002	106	229	108	232	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95836.1	1.96e-183	1	461	367	840
CCO21811.1	9.12e-180	1	452	360	823
AZN43107.1	2.04e-179	2	479	361	847
QUH30377.1	5.76e-179	1	451	359	818
QHT59778.1	1.58e-178	2	483	361	851

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001912_00512.