CAZyme Information: MGYG000001912_00726

Basic Information

• Species: UMGS1839 sp900555545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1839; UMGS1839 sp900555545
• CAZyme ID: MGYG000001912_00726
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		81014.73	6.5385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001912	1976012	MAG	Denmark	Europe

• Gene Location: Start: 2648; End: 4762 Strand: +

Full Sequence      

MMNRIFQIHYTPADTDGGFSFSNMDTEYSATSRYLTRGGKPILPISGEIHFSRCDRQDWK
RELLKMKECGLTAVANYVFWNHHEQQKGHFRWDGNRDIAEFLRICREVGLGVFLRIGPWC
HGEARFGGFPDWLMPLRGKRKDTPKYLYYVERYWRALYAQVAEFCDGETILGIQLENEYT
GTIDHIHTLRNIAERVGFKVPYFTMTSWPTNTPDKSFLQMMGGYPEAPWTYHKKPLEPAG
RFAICEGRTETEIGEDLIKGKREKATFDDFPYTGCEVGTGNQVTQHRRPIISDRDGYGVA
FAKFASGMNLMGYYMFHGGRNPRGELLQESKRTFYPNNYPIVDYDFQAPLSKDGICRKHG
DRLRLMHLFINTWDRDIARKQTFFSGEAQLPYCSVRCGGNADGYLFIGNYERGAQSAPLE
FSAQLAGDVELKLPPLQIAAKEMTFIPFRFEVRGVTFDYVTAQPVARVECGDQTDLYFMR
MERQPVVLSVNGEAFTCEAETYDAGKGVRLHFMDQECALRFHLVNGTPVFSDGTMWTHRD
AIYALLENGQQITVDGQTHTCSFEEPEDAVRMERIGKVKLPYDSYLYSHGDRGYYRLNFQ
MDRLREFDDVAVDIRFRGLNLQVFCGGVLVDDYFNTDGYYHLHIRHFRDLLERSGGEVLI
KTSAPTAHGVGHVYSEIEMKPGFEDLTLENVRPIRLEQIALKSN

Enzyme Prediction     

No EC number prediction in MGYG000001912_00726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	36	367	7.9e-70	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	6.33e-43	35	354	2	302	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.24e-23	19	367	17	339	beta-galactosidase; Provisional
COG1874	GanA	7.55e-17	35	233	8	221	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR82200.1	5.89e-110	23	684	24	715
QSS01693.1	4.49e-109	23	684	24	715
APV13328.1	4.49e-109	23	684	24	715
QDJ76141.1	4.49e-109	23	684	24	715
QJI99796.1	6.29e-109	23	684	24	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	1.15e-26	39	437	39	456	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	8.83e-26	39	437	19	436	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7KDV_A	9.54e-26	33	179	24	173	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	1.39e-25	25	219	10	206	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	1.50e-25	25	219	34	230	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GX69	7.47e-28	33	358	30	325	Beta-galactosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGAL16 PE=2 SV=2
Q9SCV1	1.38e-27	22	347	37	339	Beta-galactosidase 11 OS=Arabidopsis thaliana OX=3702 GN=BGAL11 PE=2 SV=1
O19015	2.68e-26	32	354	40	342	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
Q9TRY9	3.54e-26	32	354	40	342	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q9SCW1	5.32e-26	18	502	24	454	Beta-galactosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BGAL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001912_00726.