CAZyme Information: MGYG000001913_01211

Basic Information

• Species: UMGS731 sp900544985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS731; UMGS731 sp900544985
• CAZyme ID: MGYG000001913_01211
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837		94448.57	5.1665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001913	2038964	MAG	Denmark	Europe

• Gene Location: Start: 11486; End: 13999 Strand: -

Full Sequence      

MIIKVNALTEPFVDTEPKFSWSYPNDEFSSQKEYSISIASDADFKNIVFAKKDSTDERAN
IKTGKTFLPCKKYFVKVVSVTEDGKIYDGTTSFSTGMPKNKWEARFITGGKARKKDDVLA
AVYLRRDFSSGKNLRRAVMYIAGLGFFEAHINGKKVGDDFMSEPYTAYDKNILYRAFDVT
DMISEGENAVGVILGNGFYNCFTIDPWQTNTAPWRDVPKLLLELHLEYDDGTEKVLSDKS
WKYVEGPITFNGIRHGEEYDARLEKDGWDMPGYAGESFNVRYVMDPGANLLLSEMEPIRV
RFKYHPVSVRKVKNGWLYEIEQNQAGVAHFTFRGKKDTTYRIRYCDRLYEDGELDQKALS
CFIKNYTFQTDVYTKKSDLPEEWNAVFTYYGFKYFEVSGCEEPIDLSDIEVWSLSNDVGV
RGEFTSSDEDLNKIQKMCLYSTTSCLVNTFASDAVREKSSWTGDTGLSAEQLMINFGAEN
IMKKWQMDLRDAQRPRGCVPCIVPSPGWGYNSLNGPDWSNPAVDVPVCLYREYGDIDIVK
ENYDSLCRHVSYIGSMANGYIPSYGLGDWCPPFDGPAISVNMSAYKCPVEVSDTAYYHGA
VLAAKSFAEILGLKDDAEKYRVLAENIKKAFRENFYDPENHTVKGDCQTATGMMLYHGLA
EKDEIPYILSTLIKQIEEKDGHLDFGVLGCKAVLDSLGRYGRADIGLSVLLNKTYPSMKR
WIDEGNTTLIECWNGGGSRNHHMFSSVSAFFYKYIAGISASSPAYRDIDFCPAYFCGLES
AHAYIDTPYGRAESGFVSKDGKATVRVVVPSSCRGRLYIGNEVKELSAGVHTFEIEK

Enzyme Prediction     

No EC number prediction in MGYG000001913_01211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	313	818	3.1e-120	0.9861111111111112
CBM67	110	274	1.2e-28	0.8579545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.68e-77	422	755	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.48e-56	132	301	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.37e-13	310	412	1	99	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.38e-11	757	834	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.001	509	639	334	465	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	7.18e-178	64	824	82	845
AHF16194.1	1.96e-149	3	822	26	865
QQS95071.1	5.52e-149	3	836	29	877
QQT26302.1	1.53e-148	3	836	29	877
QNL52554.1	8.02e-147	14	836	42	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.16e-119	3	819	35	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.40e-82	95	819	276	994	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.45e-60	14	835	20	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	5.26e-88	12	825	50	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	5.09e-85	3	834	35	922	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	6.55e-82	95	819	276	994	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.49e-80	12	810	46	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998830	0.000977	0.000147	0.000007	0.000003	0.000050

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001913_01211.