CAZyme Information: MGYG000001918_00116

Basic Information

• Species: Prevotellamassilia sp900541575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900541575
• CAZyme ID: MGYG000001918_00116
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		31092.57	8.2202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001918	2523391	MAG	Denmark	Europe

• Gene Location: Start: 27540; End: 28355 Strand: -

Full Sequence      

MKLTVVTINYNNCDGLEKTLRSVTSQLTPEVEYIVIDGGSTDGSVELIKKYEKSIAFWVS
EPDKGIYNAMNKGIAHASGEYINFMNSGDCFHSSDVLSRVLPLLNGKDFYVGGQMHVYKD
KNNTLRVAPQSIKFVNLAHQALPHQATFIRTALLKKRPYDESYRIAADWEQMFYELIIDN
ASYEAIPFVVADFDMMGISNNPRNNDLQREECDRVRKTLLPNRINDFVDNSNPLQRKILY
AFGYESPMKRDMKILRNAVKLLLNDIFKRNK

Enzyme Prediction     

No EC number prediction in MGYG000001918_00116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	143	5.7e-23	0.7764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06433	GT_2_WfgS_like	1.07e-78	4	201	1	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
PRK10063	PRK10063	2.18e-36	1	219	1	220	colanic acid biosynthesis glycosyltransferase WcaE.
pfam00535	Glycos_transf_2	1.06e-21	4	127	1	128	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.07e-19	5	114	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	3.72e-17	1	89	3	94	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49128.1	1.16e-71	1	267	1	266
VFB04735.1	7.32e-58	2	221	4	224
QQV02037.1	7.32e-58	2	221	4	224
QRO25782.1	8.38e-58	3	200	6	201
QVJ80723.1	2.44e-57	1	269	1	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	4.68e-06	1	107	1	126	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	5.79e-06	1	107	1	126	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMX9	8.73e-30	3	201	7	208	Uncharacterized glycosyltransferase Rv1514c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1514c PE=1 SV=1
P9WMX8	8.73e-30	3	201	7	208	Uncharacterized glycosyltransferase MT1564 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1564 PE=3 SV=1
P71239	6.05e-23	1	220	1	220	Putative colanic acid biosynthesis glycosyl transferase WcaE OS=Escherichia coli (strain K12) OX=83333 GN=wcaE PE=4 SV=2
P0A5A0	7.32e-11	16	170	19	176	PGL/p-HBAD biosynthesis glycosyltransferase Mb2981 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2981 PE=3 SV=1
A1KMV1	7.32e-11	16	170	19	176	PGL/p-HBAD biosynthesis glycosyltransferase BCG_2978 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=BCG_2978 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001918_00116.