CAZyme Information: MGYG000001918_00227

Basic Information

• Species: Prevotellamassilia sp900541575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900541575
• CAZyme ID: MGYG000001918_00227
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1295	MGYG000001918_3|CGC1	147260.06	6.5078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001918	2523391	MAG	Denmark	Europe

• Gene Location: Start: 59212; End: 63099 Strand: -

Full Sequence      

MQEKTDFVLAYVPQNEGTDLLIKEIKDCVAVNHLYLVCTAESMQSAVQYTDERCSTIEAD
NLRSIKFLRQIAQQVTARYTIAYLSTHKLTLGYRAIERLIQATLDVDHKEQALMVYSDRY
DDQGIHPVIDYQEGALRDDFDFGSLVLYRTKDIKDFLKAEKNARYRHAAFYALRLYVSAH
GDILHVREPLYTEKETDLRASGQKQFDYVNPSNREVQLEMEKACTEHLKHIGAWLAPNEY
DELPNEDTETYPVEASVIIPVRNRVRTIKDAIHSVLEQQTKFSFNVLIVDNHSTDGTSDA
VKELAIDPRVVLITPSRTDLGIGGCWDLAIRSEHCGRFAVQLDSDDLYSSPHTLSQIVDA
FHTQKAAMVIGSYRMVNFDLQTLPPGLIAHTEWTPENGRNNALRINGLGAPRAFRTDILR
KIGFPNTSYGEDYALGLIFSRHYRIGRIFKELYLCRRWDGNSDAQLDIAHQNKNNAYKDL
LRTLELRARKAMIARWNHPLDKQETIKFFDLQMNTWDEAKQRFNDLNEKAQNRSLSLGDN
ELHVQFNPSRIVSTGAKIDAKTIKARPCFLCDKNRPTLQLSLPTMGTLQLLVNPYPILPH
HLTIPTRRHTDQEFKHFSSLIDKVAWNLPGMFVFYNGANCGASAPDHAHLQAGDRGFVPI
EKDWAYYEHKLERIYPTTKEEEADLEEMGYMPKTGGIFRLKGYACPAFVVQGPPATNGNP
ILLKKLMDALPIDKKGKEPDVNILCWRQESGPNIDDHIVTIVFPRKKHRPKCYTAEENEK
CLVSPGSIDMGGLLITPREEDFKKMTPQLATSILREVTLDDAEINAVVRKLHGRKRNATA
STESNSHHETCLLKSLVNRRISVGILHAQKVEFELNGAFMAKGAVIEGKQTVECVDGGIL
WNGNIYSELNFIPEQEGKASFTLQNVTIGIGFHWERQESQTFRGRLKLIVDEEKLVIINE
LPVEDYLESVISSEMSATSSLELLRTHAVVSRSWVYSQMLHRLKGSNRAEGYFNFVHHSD
EMLRWHDRSDHMLYDVCADDHCQRYQGITRAALPQVKQAVRDTEGEVLTFDGELCDARFS
KCCGGVSERYSACWDDTEYPYLSPIRDAASTSLPDLTNEEEAEKWIRNSAEAFCNTNDKH
LLSQVLNNYDQETQDFYRWSVTLSQEKIRTLIESKLGLEFGDIIDLKPIERGASGRLIRL
QVIGSKRTLTVGKELEIRRMLSDSHLYSSAFIVERHEVNAQTGIPALFKLIGAGWGHGVG
LCQIGAAVMADRGFSYTDILKHYYTNAHIQKLAEC

Enzyme Prediction     

No EC number prediction in MGYG000001918_00227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	256	388	1.6e-17	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	3.52e-87	616	825	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	2.39e-49	957	1291	2	267	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	3.63e-38	824	1292	36	393	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	3.38e-37	949	1292	63	338	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	2.29e-28	952	1069	2	100	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11638.1	0.0	67	1292	46	1260
QNT65264.1	0.0	1	1292	1	1258
BCS84357.1	0.0	16	1292	15	1251
AUI54371.1	0.0	3	1290	2	1246
QUB80484.1	0.0	18	1290	19	1246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RWR_A	6.61e-13	946	1290	51	318	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5I1T_A	5.10e-10	960	1292	63	329	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	6.04e-10	960	1292	87	353	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13251	4.15e-11	958	1291	73	332	Stage II sporulation protein D OS=Bacillus amyloliquefaciens OX=1390 GN=spoIID PE=4 SV=1
C0QYX7	6.65e-11	931	1289	72	351	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
P07372	3.07e-09	958	1291	72	331	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001918_00227.