CAZyme Information: MGYG000001918_00415

Basic Information

• Species: Prevotellamassilia sp900541575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900541575
• CAZyme ID: MGYG000001918_00415
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1174		129399.91	5.5899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001918	2523391	MAG	Denmark	Europe

• Gene Location: Start: 80527; End: 84051 Strand: +

Full Sequence      

MKKKSLLIGLAALLFPMSMAAQYTIYPVPHSQTAGKGTVNFTPTVNVVCEDGIDIYTRNR
VQQILGDHGLTTRITDTPIEAEANIFLGVKGSNGVAVQKAAALGLNTDVLNKANKFDRHI
LSLTDGGSGNAQLVIIGENTDATFYGLASLEQMLDQGTTGLPTVTINDYADLKERGIIEG
FYGKPYDNEVRKDLMRYMMRFKMNSYVYGPKCDPYHSSTWADPYPTTITSTQDQQGFMTQ
AKMQDLTETAHASKVNVSWAIHPGNSLLNDGQVVSKIMSKFESMYNLGFRQFAVFVDDVG
VPSQQSGMDLTCQRITDLQRAIEAKWNTPGAAAADTVKALRLTPQIYCRTFAGSDAQFNN
FFKALSKLPENVTVYYTGHGVWSVPNNTDLKTVQDQFGRNVIWWWNYPCNDNGTGPSEIY
PLDMKSNFVDMPNVGNESSLSSELTESNQGVICNPMEQGEVSKTAVFSAGDYSWNNTGFD
NMQSWEASIKSLFPGNNDATEAYRFLAPYLNKNDPETLNTILTAYKKNGNSEDLKNLLSQ
IEENCDKLGKLETSEKANESLFYKDIKPWVVRLHDLAVNINKYISVKDFGTDAEQAWPTY
INALSEFDESNESYYTHHLSGFGSTSISTEPRLTHASYRYLTPFVNYIKENATSNLFTAK
PTSTTSTGFTNVEDLRVTGTVTASLIRFQANKRGVTLNKGEYIGLELSSAIRINYVTMAD
SLLDHSKLNVVVSTDGKHWTTINRTGNEWLEKPEAGSGKYAGYARFVAIVNDSEEPTSIT
VRNGIVNLYPAQKAATSAAAAPSGAAFWQSHTANLMSDGNYNTFVCINRVQKAGDTYTIT
LKEETPVEHVRIVMGTTNGDNINKGLVQISKDGKKWTALRPTGASSNYYTLDLPQNFKVG
TVDGADVYACDFSMSNTAGKVTPTLAKYVRLYVSTPANEKWLRLHEIEVNGKGLNEMPCF
QAGQYGITEHNATDGRGYTSSANFAPYSPKDRVFTYYMTNSILLNGITLYTDPTTMEGLT
YNITTDGENWKEIEPSSAQNGIIRFTFEGENRAATALKINWNTKTVPAIYEVVENYDEAN
VERPTVTRIESVSSSSQSATEQIDLATEGSHLVAKAQSGINSVEAYTLDGRTLFSQKANG
EAHVTIPVVGATHQTILVKVTILGGKSQTFKIMK

Enzyme Prediction     

No EC number prediction in MGYG000001918_00415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	175	506	1.3e-67	0.9898305084745763

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	5.42e-105	175	506	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	4.07e-14	22	168	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
NF033708	T9SS_Cterm_ChiA	2.20e-05	1120	1173	1	54	T9SS sorting signal type C. The sorting signals of type IX secretion systems (T9SS) in the CFB bacteria are long, compared to other prokaryotic C-terminal sorting motif-containing signals, including LPXTG, PEP-CTERM, and GlyGly-TERM, and they seem to contain multiple motifs. A few T9SS substrates, including ChiA, have a variant form of T9SS sorting signal that may score poorly to both TIGR04183 (type A) and TIGR04131 (type B), depend on T9SS for secretion, but are released from the cell rather than left anchored to the cell surface.
pfam00754	F5_F8_type_C	6.27e-04	807	947	8	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11845.1	6.42e-249	3	1173	4	1134
QUT77745.1	7.83e-113	13	1073	10	1017
AHF13697.1	2.76e-102	14	1161	16	1102
BCI64753.1	2.98e-99	20	1173	20	1113
AHF13792.1	5.61e-97	20	1174	6	1245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	7.16e-68	22	645	33	617	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV4_A	3.67e-58	23	651	32	643	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PV5_A	4.62e-56	24	558	41	544	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
5MI4_A	2.13e-52	115	503	80	432	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	2.44e-52	115	503	68	420	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	1.51e-65	23	1108	39	1109	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	1.77e-51	115	503	90	442	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	3.30e-44	128	562	137	526	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	1.01e-43	128	562	137	526	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
O60502	8.24e-14	176	476	63	335	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000281	0.999006	0.000170	0.000187	0.000172	0.000161

TMHMM  Annotations     

start	end
7	26