CAZyme Information: MGYG000001918_01543

Basic Information

• Species: Prevotellamassilia sp900541575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900541575
• CAZyme ID: MGYG000001918_01543
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		26420.99	10.2468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001918	2523391	MAG	Denmark	Europe

• Gene Location: Start: 23512; End: 24198 Strand: +

Full Sequence      

MLNLFFKILKIAFLFFLLSSVLAVFYYKWMPVKITPLMAIRSIEHVVKGEPPIVHHKWVS
LDEMSRYMPVAVMASEDQQFLHHHGFDFGAIQDAAVDRLKGRARRGGSTISQQTVKNVFL
WPSRSWIRKGFEAYFTVLIELLWSKERIMEVYLNSIEMGTDIYGVEAVAKQNFGCSALEL
RRGDCALIAATLPNPRRFSSYKPSSYVRKRQREIEHQMKFIPLISSQK

Enzyme Prediction     

No EC number prediction in MGYG000001918_01543.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	55	219	3.2e-50	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.21e-109	1	218	4	223	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	6.91e-83	6	218	4	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	8.29e-65	1	219	8	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.29e-64	49	219	6	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.38e-33	1	218	1	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKU69983.1	3.16e-92	6	222	6	223
QUB85593.1	3.16e-92	6	222	6	223
QUB83050.1	3.65e-91	18	222	18	223
QNT65514.1	6.04e-91	7	222	8	223
QKH87573.1	1.48e-90	18	222	18	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.13e-27	58	210	22	176	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.21e-26	58	210	22	176	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	8.38e-19	58	174	59	175	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
7U4H_A	8.54e-19	44	202	28	185	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3VMQ_A	1.10e-18	58	174	76	192	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A8H2	1.77e-82	7	222	9	227	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V7G2	5.45e-79	6	222	7	223	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q3V815	5.45e-79	6	222	7	223	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q3V7R3	5.19e-62	12	214	15	217	Biosynthetic peptidoglycan transglycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mtgA PE=3 SV=1
Q9ABA6	1.77e-60	7	214	11	212	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000005	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
5	27