CAZyme Information: MGYG000001920_00213

Basic Information

• Species: Phocaeicola sp900546355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546355
• CAZyme ID: MGYG000001920_00213
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000001920_3|CGC1	35942.25	9.0814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001920	3068459	MAG	Denmark	Europe

• Gene Location: Start: 57853; End: 58779 Strand: -

Full Sequence      

MRINCVVVTYNRVALLKENLSALKSQTYPIHQIFIINNHSTDGTEAYLSTFNNDPQMKIY
HLDKNIGGSGGFSYGIKQAVLNGCDYVWIMDDDTIPEEDALEQLIKATALDTHIGFVSSK
VVWTDGEIHKMNKCGIRQPIQKKTLTDNPSVYGLACNNATFVSTLIKAEAVYKVGLPYKE
FFIWHDDIEYTERIVHQGYTAYYIEQSVVTHKTNSNYAPRVYEADPKDLWKFYYQARNTT
FLTRLRKPNVFIFYFSILNKYRNYMRRIKRMEDKECQKLLRKEIRRGCIDGLKFRPQIEY
ISPNALRM

Enzyme Prediction     

No EC number prediction in MGYG000001920_00213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	113	9.1e-23	0.6235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	9.02e-80	5	242	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.70e-43	1	293	3	302	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.04e-27	6	213	2	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	2.86e-26	6	242	2	236	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd00761	Glyco_tranf_GTA_type	1.21e-22	6	119	2	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ48790.1	7.28e-103	1	302	1	304
QTO26782.1	7.28e-103	1	302	1	304
QQT78195.1	2.57e-97	1	301	1	301
QRP56561.1	2.57e-97	1	301	1	301
ASM65277.1	2.57e-97	1	301	1	301

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	4.88e-11	6	242	10	254	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	1.80e-09	6	238	8	247	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	1.80e-09	6	238	8	247	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
Q8GLC5	1.15e-08	10	175	56	217	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	1.15e-08	10	175	56	217	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001920_00213.