CAZyme Information: MGYG000001921_00532

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia
• CAZyme ID: MGYG000001921_00532
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997	MGYG000001921_2|CGC3	108548.37	9.4899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001921	2759672	MAG	Denmark	Europe

• Gene Location: Start: 165270; End: 168263 Strand: -

Full Sequence      

MNLILFQSMMAAAALGAGLAFPVSAQSSSPACSAAPEDSRAGKTAKMPVYPIPQKMTRSG
GSVTVPALKLSGARDEPTVNALKSMFSIAPNGLPVQMTIIKGSKKPAGNVPRKAGAYSLS
VTPQGIRMTGYDDEGLFYAAQTLLQLAEKTSSGVMVPTVEILDWPDVPFRGTIEGFYGLP
WGQEGRISQFKFYGKYKMNTYIYGPKDDVFHGFSKRWREPYPADMAKDLKELVKVAKQNK
VNFVWAVHPGADIHWGEADRKAAVKKFEMMYDLGFRSFAVFFDDIGGEGAKPEGQVEFLN
YLNKEFIHKKPDVTPLIVCPTAYSGGGGRYHEVMGEHLDKDIGIMWTGSSIVSDIRTPAL
KGINKYLKRPAFIWWNFPVTDYVRHALFLGRTYGVDADAMPFMQGFASNPMDKPEASKIS
LFSVANMTWNAKAYDSDRTWKDSIRILFPGCSSAMQTFADHNSDGGPSGHNYRKEESVEI
APVVEQVLELCRRGARVSGSKAFDRLKAEFAKMAQAPDAIRAKSDNPAFVAEVEPWLIQF
ESLGKAGVNSMRMIEATEAGNGAGALNHAMEAACLLAEMQRYSREISKAINKHVTEVTKK
NSPWQTAVKPSELVMAPAVRELLDMGSTSVLSRVSGRAVGRVKPYVSTKSKGGIEKMLDD
DPESFYYCKEVQKKGDFFGVDLGVPREIRTVSIVMGRNDSDTDAVNRGQLEVSLDGQSWF
PLMPESSGLHVEYQGSGKKGRFVRYRATAQGVPGGKPDVWTAIRDFKVNAPAAPSVLTDA
PAFRNAVVETGDRDISLKRIMEVHPLSPRKSLGIQIPAGASVESASVNLKTPDMKWAKLY
ISMDGKSWAEVPLKADGSAEVGGVIKGIRLLNAGSVPQEVTLEEFKLSLANRGGKSADNG
AAGDFNLATFLPVELSPERAEIPCNFPRANSAIVLSDGKEASVLACGADGRWVPVGNLTK
DRKVNTFSLKSVKKPVKALGLTGKKGSSVNIFEVIWK

Enzyme Prediction     

No EC number prediction in MGYG000001921_00532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	170	459	1.2e-99	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.25e-143	170	458	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	7.31e-18	46	163	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	3.71e-08	82	171	175	265	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	1.31e-07	650	755	10	120	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	0.003	666	719	36	89	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV55174.1	0.0	1	997	1	997
QHV57548.1	0.0	1	997	1	997
QHV60912.1	0.0	1	997	1	997
QHV52808.1	0.0	1	997	1	997
QQR32548.1	0.0	1	997	1	997

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7K41_A	2.07e-143	42	719	1	671	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J4G_A	3.63e-143	49	719	4	667	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	3.73e-143	49	719	5	668	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	3.73e-143	49	719	5	668	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
5MI4_A	5.14e-143	49	719	16	679	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	3.76e-142	49	719	26	689	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	4.34e-80	113	719	129	712	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	5.93e-80	113	719	129	712	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	2.12e-51	49	769	41	795	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	1.39e-34	171	429	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001293	0.997417	0.000542	0.000302	0.000224	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001921_00532.