CAZyme Information: MGYG000001921_01928

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia
• CAZyme ID: MGYG000001921_01928
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	MGYG000001921_11|CGC1	94745.95	9.3164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001921	2759672	MAG	Denmark	Europe

• Gene Location: Start: 83; End: 2641 Strand: +

Full Sequence      

MFSHVAAVGAVLGTVMSPLVCVSAAERSPVAAAEDVVARVTPSAKGSVLFHLNPDLGNKI
TISGVAGGIRVEASDVRRLVAGYGWYLKNIAKVHFSWNGDRMALPSPLPVPTRPVTIESP
WNIVFAYNYCTLSYTAAFWDWSRWQREIDFLALNGFTHALVTAGLEKTWEDFLTGLGYPR
EKILRFIPNPAFAAWWNMGNLEGHGGPLSQQQINKMAQMGKRIVSRMEQLGMTPVLQGYV
GFVPSDFQDNVQIDGLKLIPQGEWVNFKRPWVVDPTCEAFPKLAADWYKALRKVYGIPGK
MFGGDLFHEGGRKGGIDVTHAAQAVQKAMQKASPGAFWVIQSWGGNPTRELLDGLDPEYA
LILQLTKDMANGGKNLKTFNGIPWVWCELANFGGNTGLYGGIPLLSRLGSDLAGYGDKGL
VGMGTLSEGLETNPLHYALFSDRLWTKEDISVREWLGRYALQRYGSAPKAVVKALEVLSS
SIYNPVRSQEGCTESIICARPSWNVRKASTWSSGERYYHLGDIVKAARGYLKAANDQPDL
VKRETFRYDLVDVVRQSLADAAFYQLQQVRNAFDSGDAAAYKKQVKRFLSLISDMDALLA
TDSQFLLGTWQKRALDWGNSRQEKALMDKSAKMLVTTWIDQAPRSLNDYSNRQWAGLVSD
FYLPRWRNFFESQMDVLTGKKTRDAAHVAFMDKTVREELAFAGNGKIYSTKPSGDTLSVA
NRVMNNHRKMLDALSAEERHSSGSPWELQQGSPLQFDVTDQVTASGTYTVTFQWKNGPSA
LKIHSVRLYEGNREVAADVHEGRTGVENKDNVYRLELKKYRTNLDSYILKAEVSGVSQGA
SKGEMMLKRLVN

Enzyme Prediction     

No EC number prediction in MGYG000001921_01928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	67	725	9.6e-212	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	9.49e-131	125	447	2	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.86e-86	455	721	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.20e-19	31	109	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBH16707.1	0.0	1	852	1	852
QWP64831.1	0.0	1	852	1	852
QHV14058.1	0.0	1	852	1	852
QWP46142.1	0.0	1	852	1	852
QHV16528.1	0.0	1	852	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	6.62e-113	67	679	212	830	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	7.90e-113	67	679	220	838	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	8.06e-112	67	679	235	853	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	6.07e-92	26	723	2	707	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	5.57e-91	26	723	25	730	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	4.01e-88	56	727	91	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002506	0.652097	0.344412	0.000484	0.000247	0.000227

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001921_01928.