CAZyme Information: MGYG000001921_02216

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia
• CAZyme ID: MGYG000001921_02216
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		51994.53	7.5411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001921	2759672	MAG	Denmark	Europe

• Gene Location: Start: 35313; End: 36734 Strand: +

Full Sequence      

MSIFPSRRQFLKSLGLAAGAAAAGSVFPGQAVEIPAGDHLWKSSSPEVPRPSGSTYMGGF
KAPRLDRIRLAFIGVGGRGFSHLAQMCVMDGVEIVGICDLKEELTKRGVDRVLSRMGKSP
LGYSGGDTEYLTMLKELKPDAVIISTDWSSHARIACDSMKHGAHAFVEVPLAVSMEELWN
LVDTSEATRKHCMMMENVNYGRDELMFLNMVRQGVIGDLLHGEAAYIHCLVTQLGDTRGE
GAWRPEYHTRINGNLYPTHGLGPVAQYMSLERGEDRFSRVAAFASPALGRNAYAKKHLPA
DHRWNNTPFICGDMNTAVIKTQLGRTVLVQLDETSPRPYSRANLIQGTEGTLAGFPTRVA
GEKLGSGNYHEWIEGREKLAAIYEKYDHPLWKRIGELATKMGGHGGMDFVMLFRIVECLR
KGEPMDQNVYEGAAWSSLLPLTARSIAQGGLPVEFPDFTRGDWKNTAPLPVVS

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	64	465	1.1e-156	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.56e-18	67	228	3	157	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.02e-10	68	197	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP45591.1	0.0	1	473	1	473
QWP32740.1	0.0	1	473	1	473
QWP35198.1	0.0	1	473	1	473
QWP40086.1	0.0	1	473	1	473
QWP37639.1	0.0	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	0.0	26	473	1	448	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.67e-76	67	465	20	433	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UQL7	0.0	1	473	1	473	Glycosyl hydrolase family 109 protein 2 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0920 PE=1 SV=1
B2UL75	3.15e-231	6	472	6	480	Glycosyl hydrolase family 109 protein 1 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0017 PE=3 SV=1
Q0HKG4	3.89e-166	7	472	6	457	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_1375 PE=3 SV=1
Q0HWR6	3.16e-165	7	472	6	457	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_1440 PE=3 SV=1
Q8ECL7	4.47e-165	7	472	6	457	Alpha-N-acetylgalactosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	1.000009	0.000002	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001921_02216.