CAZyme Information: MGYG000001923_02105

Basic Information

• Species: Parasutterella sp009767915
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Parasutterella; Parasutterella sp009767915
• CAZyme ID: MGYG000001923_02105
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223		25588.54	10.0553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001923	2305067	MAG	Denmark	Europe

• Gene Location: Start: 1403; End: 2074 Strand: +

Full Sequence      

MFLFLLLAVFALELFYIARIALFAFIDPSSTPYMRQEEDRLSENAPHPVRYSWVDYDKIS
PYMKSAVVAAEDANFMHHNGLQWGAILTAAQRNLLSERHAPGGSTLTQQTIKNLFLSHDR
SYFRKIQEIILAPIVEALWSKKRILEVYLNIAEFGNGIFGVEAASRAYFHKSASQLNRNE
AIRLASILINPKKYHINSNSSLIQRRVHRIANDMRLVDIPKNK

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	50	214	4.7e-59	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.49e-94	14	220	21	229	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.39e-77	14	220	16	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	6.93e-72	47	215	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	6.22e-65	20	215	45	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.02e-42	50	206	66	223	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ97963.1	3.99e-89	13	223	29	239
ANU66032.1	4.12e-89	13	223	30	240
QDQ86330.1	1.31e-57	13	220	27	239
QQN71732.1	1.16e-56	12	220	18	242
AIJ48985.1	1.99e-56	12	220	18	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.14e-33	53	195	22	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.42e-32	53	195	22	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.79e-23	33	207	39	219	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.26e-23	33	207	3	183	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	2.31e-23	33	207	4	184	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WF82	2.99e-55	13	220	30	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=mtgA PE=3 SV=1
Q7W039	2.99e-55	13	220	30	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=mtgA PE=3 SV=2
Q7W3V2	2.99e-55	13	220	30	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=mtgA PE=3 SV=1
Q3SFZ8	8.91e-55	27	221	37	232	Biosynthetic peptidoglycan transglycosylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=mtgA PE=3 SV=1
A1K3B8	2.45e-54	6	220	12	230	Biosynthetic peptidoglycan transglycosylase OS=Azoarcus sp. (strain BH72) OX=418699 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.975579	0.024040	0.000151	0.000071	0.000044	0.000126

TMHMM  Annotations     

start	end
4	26