CAZyme Information: MGYG000001925_00066

Basic Information

• Species: Phocaeicola sp900544675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544675
• CAZyme ID: MGYG000001925_00066
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
907	MGYG000001925_1|CGC3	103313.87	5.0972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001925	3441241	MAG	Denmark	Europe

• Gene Location: Start: 73540; End: 76263 Strand: -

Full Sequence      

MKKTSLFIGFILTCLIGMPSFAKDYTLFSPDKQLKIEVTDGNNLLTYSIYHKNSLILVKN
QIGLVGLDKPLAAGKAIKVTSKKSRTVVQDITSPFYRFKSFHTACNEMNLKLKGDYGVIF
RAYNEGVAYRFYTTAGKDKEIIIAGETAEFNFPDNYTAYLPYTTNEEKPMAMAYQATYEV
KPLAEARKQLAFLPVTVDCGNVKVTLLESDLEAYPGMFVEPTGANGLKGVFAPYPKKTDY
YPWRKQLYVTETENYIAKVKGTREYPWRVLAITEKDTEMPVNNLIYALASPNRIGDYSWV
KPGKVAWEWWNDWNLKGVPFSTGINMDTYKYYIDFASRNGLEYIVMDEGWYDPKSGDMLT
TIPAIDLPELVAYGKKKGVDIVLWTVFNVLDDQLEAACKKYSEMGIKGFKVDFLDRDDQT
AVEMAYRIAEKAAEYKLILDYHGIYKPTGMNRTYPNIVNYESVFGMEEAKWSDVEKNMPL
YDVTFPYIRMMAGYVDYTPGAMRNATKRDFKPMYYTPQSMGTRAHQLAAYIVYDSPFTML
CDAPTNYMEEQECTDFIASLPVETDSTMVLAGELGKYIVTARKKDINWYVGGMTNWDERD
LIVDFSFLGEGETYACTLMADGINASKQAEDYTCKQMEVTRDTRMNLHLASGGGFAMKLE
LRPQQGAVTGIPEGKQIPDFYKKYIETEGLYVTSSERVSDKALLKACDIISLMLVKRPDI
KAHMVKEGCHVMVIGKDEETCDLPEFAHICNSEDSINYWNKRARGFGGAPEDTYSSSCGE
ENLLALPQDKYVGENILVHEFAHLIHTIGIVGVEPEFNDRLEALRQNAIQKGLWKDTYAV
SNKEEYFAECTQSFFNCNRYAKEANGVHNQVNNRTKLKAYDPDMYNLLKEYFYEIDLPLY
NNCKEGY

Enzyme Prediction     

No EC number prediction in MGYG000001925_00066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	16	659	4e-193	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	2.14e-134	296	561	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.10e-54	29	291	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	6.22e-40	565	659	2	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
pfam06167	Peptidase_M90	6.79e-07	793	892	146	242	Glucose-regulated metallo-peptidase M90. MtfA (earlier known as YeeI) is a transcription factor A that binds Mlc (make large colonies), itself a repressor of glucose and hence a protein important in regulation of the phosphoenolpyruvate:glucose-phosphotransferase (ptsG) system, the major glucose transporter in E.coli. Mlc is a repressor of ptsG, and MtfA is found to bind and inactivate Mlc with high affinity. The membrane-bound protein EIICBGlc encoded by the ptsG gene is the major glucose transporter in Escherichia coli. MtfA is found to be a glucose-regulated peptidase, whose activity is regulated by binding to Mlc available in the cytoplasm, which in turn has been released from EIICBGlc during times when no glucose is taken up. A physiologically relevant target for this peptidase is not yet known.
cd20169	Peptidase_M90_mtfA	1.37e-06	793	892	110	208	Mlc titration factor A (MtfA) is a zinc metallopeptidase (M90 peptidase). This subfamily includes the Mlc Titration Factor A (MtfA; also known as YeeI or DgsA anti-repressor MtfA) which is involved in the control of the glucose-phosphotransferase sensory and regulatory system by inactivation of the repressor Mlc (making large colonies). It can cleave synthetic substrates of both carboxypeptidases and aminopeptidases, with strongest activity towards the latter. Its biologically relevant substrate has yet to be identified. Although it interacts with the transcription repressor Mlc, it does not cleave it. However, Mlc seems to activate the peptidase activity of MtfA. MtfA is related to the catalytic domain of the anthrax lethal factor which is a zinc-dependent metalloprotease, targeting mitogen-activated protein kinase kinases (MAPKKs), and resulting in apoptosis, as well as the Mop (modulation of pathogenesis) protein involved in the virulence of Vibrio cholerae; although sequence similarity is low, conservation is observed in the overall structure as well as in the residues around the active site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38815.1	0.0	12	905	14	907
QQY38934.1	0.0	12	905	14	907
QEW34704.1	0.0	12	905	14	907
QQY42155.1	0.0	12	905	14	907
QUT60185.1	0.0	12	905	14	907

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	1.39e-203	29	660	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	2.51e-202	29	660	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	2.91e-56	26	660	2	659	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	3.96e-56	26	660	2	659	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	9.95e-56	26	660	2	659	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	7.62e-206	1	660	1	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	7.21e-49	12	656	20	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	4.49e-42	1	671	1	735	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000412	0.998501	0.000541	0.000176	0.000180	0.000173

TMHMM  Annotations     

start	end
5	22