CAZyme Information: MGYG000001925_00570

Basic Information

• Species: Phocaeicola sp900544675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544675
• CAZyme ID: MGYG000001925_00570
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720		83620	5.4893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001925	3441241	MAG	Denmark	Europe

• Gene Location: Start: 104507; End: 106669 Strand: -

Full Sequence      

MKLKKLLLASLLCLLPFSLFANPVKNLLERIDPGASKKFVIQLQKNADNDFFELDQKGDK
VVVRGNTYVNIATGLNWYLKYYAGIHLSWNNMKAQLPDTLPPVTQPERHETNLSLRYDFN
YCTYSYTMAFWDWARWEQEIDWMALHGINLPLAAVGQECVWRNMLAKLGYTKEETNRFIA
GPAFLAWWAMNNLEGWGGPNPDSWYEQQEALQKKILKRMHEYGIEPVLPGYSGMVPHDAN
QKLGLNVTEPELWNGFTRPAFLSPTDERFAEIAALYYEEQEKLFGKANYYSIDPFHEVEN
AGAVDFDAAGKAVMNAMKKVNHKAVWVVQGWTENPRPEMIKNLKNGDLLILDLFSECRPM
WGIPSIWKREKGYEQHDWLFCMLENFGANVGLHGRLDQLLNNFYLTKNNPLAAHLKGIGL
TMEGSENNPMMFELMCELPWRPDKITKEAWLKEYLAARYGAKDEKIEQAWKILADGIYNC
PFGNNQQGPHESIFCGRPSMNNFQVSSWSKMENYYDPTSTEEAARLMLEVADKYRGNNNF
EYDLVDIVRQALADRGRIVYNQAIADFKSFDKRSYARHSQEFLRLLLAQDSLLATRSEFR
VGRWINQARSLGNTPEEKDLYEWNARVQITTWGNRECADKGGLRDYAHKEWNGILKDFYY
KRWAAWWQMLQGVLDGGEMKEIDWYAMEEPWTLEHNPYKSEAEGDCIDTARQVFKLLNED

Enzyme Prediction     

No EC number prediction in MGYG000001925_00570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	58	714	8.7e-260	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	116	442	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.40e-109	450	711	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.04e-32	22	101	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36941.1	0.0	1	720	1	720
QDO68555.1	0.0	19	719	19	718
QUT88634.1	0.0	1	715	1	714
ALJ60359.1	0.0	1	715	1	714
QJR53605.1	0.0	7	718	10	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	7.85e-160	22	720	172	883	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	9.76e-160	22	720	180	891	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.14e-158	22	720	195	906	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	4.84e-129	21	714	6	708	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	6.23e-129	22	714	47	801	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	2.51e-128	21	714	29	731	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999068	0.000201	0.000156	0.000153	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001925_00570.