CAZyme Information: MGYG000001925_02239

Basic Information

• Species: Phocaeicola sp900544675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544675
• CAZyme ID: MGYG000001925_02239
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		70174.74	5.344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001925	3441241	MAG	Denmark	Europe

• Gene Location: Start: 10755; End: 12572 Strand: -

Full Sequence      

MKRFWITLTIFSFLYVSGFAQWKPVEGKIKTTWAEQVNPENVLPEYPRPIMERTEWQNLN
GLWEYAIIAKGSRTPEIFDGKILVPFAIESALSGVGKRMDEKSELVYRRTFSVPSKWKGQ
RILLHFGAVDWQTDVWVNGIKIGNHTGGFTPFSFDITGALKTKGENTLLVKVWDPTDKGY
QPRGKQVSEPNGIWYTPVTGIWQTVWLEPVHAVHIDYLRITPDIDNNRLYLEPVMNRATA
DDLVEVIVMDGQTQVALGKSINGETIQIEMPENVKLWSPDSPFLYTLKITLKHQGEKVDE
ISSYAAMRKYSSGRDENGIVRLELNNKPLFQFGPLDQGWWPDGLYTAPTDEALLYDIQKT
KDFGFNMIRKHIKVESARWYTYCDKLGIIVWQDMPSGDHNPEWQNRTYFDGTEMKRSYES
EQCYRKEWKEIMDCLYSYPCIGTWVPFNEAWGQFKTPEIVEWTKHYDPTRLVDPASGGNH
YTCGDMLDLHNYPAPEMYLYDAQRATVLGEYGGIGWVVKDHIWEPERNWGYVQFNSSKEV
TDEYVKYADMLYKLIPRGFSAAVYTQTTDVEVEVNGLMTYDRKVIKMDEKRVKEINEKLC
NSLSY

Enzyme Prediction     

No EC number prediction in MGYG000001925_02239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	509	4.2e-104	0.5186170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.44e-36	46	533	1	492	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.96e-28	48	472	3	445	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.45e-23	44	481	56	474	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	1.57e-15	106	207	68	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	2.27e-12	213	308	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89074.1	0.0	1	603	1	603
ALJ59901.1	0.0	1	603	1	603
QUU01249.1	0.0	1	603	1	603
QBJ18527.1	0.0	1	603	1	603
QMI79934.1	0.0	1	603	1	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	0.0	20	603	3	586	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5EUV_A	4.28e-25	57	407	5	339	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d],5EUV_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d],5LDR_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d]
5LDR_A	4.29e-25	57	407	6	340	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d]
3GM8_A	8.43e-25	107	488	70	435	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6ED1_A	8.84e-24	107	471	81	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	3.58e-24	107	451	107	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	4.22e-24	107	450	60	389	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
O52847	1.77e-23	107	511	137	548	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
T2KM09	5.18e-22	107	477	110	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
A1SWB8	2.44e-19	57	487	49	498	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.033696	0.928287	0.036696	0.000530	0.000373	0.000388

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001925_02239.