CAZyme Information: MGYG000001926_00083

Basic Information

• Species: CAG-776 sp900549285
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-776; CAG-776 sp900549285
• CAZyme ID: MGYG000001926_00083
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 2D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		70390.88	4.1611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001926	1177391	MAG	Denmark	Europe

• Gene Location: Start: 71834; End: 73723 Strand: +

Full Sequence      

MIGLYLYAYLSPKLELRTAGQYYIYDGNDELVYQGSSTSEWVSLEDINYNLINAVISVED
KNFYQHHGFDYLRIARAMYLNIKNGKITQGASTISQQYVKNIFLDFSTTWSRKIKEAFLT
LELEVHYTKDEILEGYLNTINYGQGNFGIGNASRYYFNKDPIDLTLEESLILAGIPNSPE
NYNPVANYDLAIKRALIVAQSMVLNGYLSQEEYDSLFQDEISIYGKSSLENLDMLMYYQD
AVIEELKSIHTIPEELLQAGGIKIYTYLDLDAQKDLEENILSYLSNSDLQSASVVIDPDT
GGVIALSGGVSYAESQYNRATQAKRQVGSTMKPFLYYGALEEGMTSASTFNSQYTTFTLS
NGDIYSPKNYGSIYANKEITMAEAIAVSDNVYAVKTNMFLGASKLVETASKVGIEAQLEP
VASLALGTKEMSVLDLARGYTTFATGGYKEDIGFIRKIVDSEGNILYEKEEAKELVLNMN
YNYILTEMLTGTTNSRFKDYANPTALTIASKLSRKYAIKTGTTDTDFWIAGYNPDIVMVT
WVGMDDNSPLSASDSYISKNIWAETVEDILADTEEHWYETPLNVVGVVLDAVSGIPTNDT
SKATLYYFVKGTEDVIQTEYVSKEEEIEE

Enzyme Prediction     

No EC number prediction in MGYG000001926_00083.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	36	203	3.6e-63	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	40	564	3	523	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	8.22e-177	1	575	32	602	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.36e-137	2	625	22	775	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	4.21e-101	51	549	159	662	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK11636	mrcA	4.79e-81	6	624	25	835	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF93690.1	2.80e-165	1	613	26	642
BAC14973.1	2.80e-165	1	613	26	642
CBF97210.1	2.80e-165	1	613	26	642
ASV67977.1	7.57e-164	1	622	34	658
QQZ09247.1	1.89e-163	3	623	36	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	4.88e-64	51	549	168	673	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	6.60e-64	51	549	189	694	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3DWK_A	5.72e-61	24	606	10	625	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3FWL_A	6.02e-61	51	549	172	677	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
4OON_A	8.93e-59	24	594	23	747	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70997	5.17e-147	11	613	46	652	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O66874	2.25e-80	41	613	65	711	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	2.65e-75	11	584	40	610	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
A0A0H2ZMF9	2.59e-71	1	573	68	655	Penicillin-binding protein 2a OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=pbp2a PE=1 SV=1
Q8DNB6	2.59e-71	1	573	68	655	Penicillin-binding protein 2a OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbp2a PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.980224	0.019548	0.000143	0.000043	0.000021	0.000045

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001926_00083.