CAZyme Information: MGYG000001927_00022

Basic Information

• Species: Prevotella sp900547005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900547005
• CAZyme ID: MGYG000001927_00022
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		39411.75	7.8852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001927	2803818	MAG	Denmark	Europe

• Gene Location: Start: 26052; End: 27107 Strand: -

Full Sequence      

MLACVDKRKPEVTPWGTVVGEEQQAGNGKYSLDDIIGSGEMIALTISGPDTYYDYHGHGM
GVQYMMCENFAREIGVTLRVELCKDSAEMVRKLKEGYGDVVAVMLPKGSKADKGLRYCGA
SDKNRNIQWAVAKDNVSLAEALDKWYRPEMPEQTRKREDYLLSAASVTRRVYAPVLDKSR
GIMSNYDTYFRQYAPVAGVDWHLLAAQCYQESCFDSQARSWAGACGLMQLMPSTAARFGL
SREEIFHPEKNIAVGARFMGSLMQSFRDVPNNYERINFALAAYNAGPGHVRDAMALARKN
GESPYSWAVVSQYVLLLSSPEYYQDPVVKHGYMRGSETVNYVSSIRRRYGY

Enzyme Prediction     

No EC number prediction in MGYG000001927_00022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	200	349	7.9e-29	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	4.29e-77	190	349	1	156	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	5.95e-51	12	349	22	447	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	6.98e-40	32	350	16	429	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	2.96e-30	186	291	6	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	6.37e-26	198	305	9	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	6.87e-140	1	349	45	391
EFC70077.2	6.97e-140	3	349	17	360
QUB48180.1	5.67e-139	3	349	18	361
QNT65891.1	2.83e-138	1	350	16	380
BCS86517.1	3.04e-138	3	349	9	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.18e-22	183	349	256	418	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.24e-22	183	349	263	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.24e-22	183	349	263	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	1.40e-22	183	349	249	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.40e-22	183	349	249	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KJ50	1.68e-30	32	349	40	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A4SNZ5	1.02e-28	85	349	186	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
A8H256	1.20e-28	129	349	238	437	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1
B1JDH3	2.38e-28	88	349	185	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain W619) OX=390235 GN=mltF PE=3 SV=1
A8ZWR8	1.61e-27	115	349	213	445	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001927_00022.