CAZyme Information: MGYG000001927_00307

Basic Information

• Species: Prevotella sp900547005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900547005
• CAZyme ID: MGYG000001927_00307
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001927_2|CGC4	36448.38	8.2168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001927	2803818	MAG	Denmark	Europe

• Gene Location: Start: 159311; End: 160285 Strand: -

Full Sequence      

MRKTTVLMLLLVMAIAANARGKYDNTDTLVVARDGSGEFRTVGEAVEVCRAFMEYRKVIF
VKKGTYKEKVIVPSWLTNIEIIGESRDNTIITYDDHANIKSSETGKPMGTFRTFTVKVEG
SDITFRDITIENNAEKLGQAVALHTEGDRLKFINCRFLGNQDTVYTGVAGTRLLFKDCYI
DGTTDFIFGPATAWFENCDIHSKADSFITAASTPQNVKYGYIFNNCRLTADAGITKVYLG
RPWRAYAHTLFMNCTLGRHIVAEGWRNWKDYHDPAAEGIVRYMEYNNRGEGAGTSQRVGW
SRILSKKEATKITSQEVLGEWSSQ

Enzyme Prediction     

No EC number prediction in MGYG000001927_00307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	318	8.7e-102	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	9.52e-80	30	319	3	296	Pectinesterase.
PLN02773	PLN02773	2.58e-69	29	309	7	287	pectinesterase
PLN02682	PLN02682	4.20e-63	28	314	70	357	pectinesterase family protein
COG4677	PemB	5.40e-62	27	321	81	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02301	PLN02301	1.75e-60	29	321	238	536	pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	1.01e-161	1	322	1	321
ADE82952.1	1.01e-161	1	322	1	321
BCS84477.1	4.34e-159	1	317	1	314
QJR97878.1	1.67e-152	14	324	7	319
AGB28242.1	4.01e-152	1	317	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.94e-47	29	321	9	307	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.72e-43	29	321	11	294	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	7.40e-43	30	300	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	9.38e-43	29	321	11	294	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.53e-35	26	322	3	338	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.78e-51	31	309	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	4.68e-50	28	313	272	562	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
O80722	1.86e-49	30	319	278	572	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1
Q9FM79	2.86e-49	15	318	65	372	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q5MFV6	4.98e-49	28	317	276	567	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999179	0.000145	0.000148	0.000135	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001927_00307.