CAZyme Information: MGYG000001927_00495

Basic Information

• Species: Prevotella sp900547005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900547005
• CAZyme ID: MGYG000001927_00495
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000001927_4|CGC1	41619.82	9.7749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001927	2803818	MAG	Denmark	Europe

• Gene Location: Start: 89042; End: 90112 Strand: +

Full Sequence      

MIVKNKKKDVLVFNFNCFRRSLYCDYVGKIDNNRNMRRLFISLMLTLTAFIANAQPSAIA
PQDYQQMLKKGIDVDWWGRSEKNKYGAYSETAVKRFAQQGIKHVRFRLHHYRFTNEDFKR
LFSQINTCMQNDLIPIIAFSAKPYKENPNAEEHEKVVKWWKIMAERCKDLSPKVSFDLIV
EPSDKVKKDVAELNSLYEDCVATIRKTNPKRIIFIAPPKLSHPEGLKYLQAPSQSNGYLM
AEWHFYAAGPSKTNNKKRWTSGTAEEKQLIKKSIKVAVDWQKETGIYTWVGAWMPGDYNK
GDNYSVKEQIEFASFMTQQLDKYGIPFAINSDDKFYDYQAENWIPKYKDLLNSIFP

Enzyme Prediction     

No EC number prediction in MGYG000001927_00495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	101	329	1.3e-26	0.9083969465648855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.30e-12	76	328	18	264	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66002.1	3.20e-247	7	356	2	351
QIB28168.1	1.20e-102	59	355	5	298
QMW91197.1	1.35e-102	39	354	13	321
BBK76626.1	1.35e-102	39	354	13	321
QUF84801.1	1.91e-102	39	354	13	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RJX_A	5.19e-10	63	344	15	310	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]
3RJY_A	5.19e-10	63	344	15	310	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]
3AZR_A	1.65e-09	98	354	44	310	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3NCO_A	1.67e-09	125	344	88	310	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
6UJE_A	1.67e-09	111	291	64	250	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16218	7.96e-08	53	291	321	564	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.645503	0.304051	0.047617	0.001915	0.000559	0.000349

TMHMM  Annotations     

start	end
39	61