CAZyme Information: MGYG000001928_00738

Basic Information

• Species: UMGS75 sp900752975
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UMGS75; UMGS75 sp900752975
• CAZyme ID: MGYG000001928_00738
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		57925.73	5.21

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001928	1595171	MAG	Denmark	Europe

• Gene Location: Start: 735; End: 2276 Strand: +

Full Sequence      

MKKLEEMTLQEKIGQLIIVGFPSSYYDENLKTLVEKYKCGNVIMFTRNFQNASQMKKLCT
DVHKNIYKETGLYPFISIDQEGGLVTRLMKDVTFPPSQMTSSASAIPNAPYLVGKMIGRD
MIRLGLNIDLAPCLEINPNLENELTNVRSYSSDPVVAGKYAHDFIKGLKENGVLGCAKHF
PGAGDDKVDSHLELPIIDIDKETMHKTGLVPFKENLDVPCIMTTHTLFTIYDTVPATLSK
NILGGLLRSELNYQGLIMSDCMEMKAIADHYGSANGALMSLKAGCDFVLVCHTFETQVEA
FEKVYQAALNNELTIEEIDEKVERIIKFKEMTLPYLEKYFFNNDEYQVSTENNNLASTIV
DKSLTKILGNEPILTVDSLVLTPKASVSSIVEDEFDDRSLSRVLHKEFPNAKVYEFSNDD
KAIETIKSEVTTTNNIIIFSYDVSKDEKQKNLINEILRTGKECYVISLKGPMDQKEFVNL
KNYLCLYEYTPNSIKTIVKYLKKEIKPEGKLPK

Enzyme Prediction     

No EC number prediction in MGYG000001928_00738.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	70	290	2.7e-49	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.04e-76	7	377	1	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.83e-74	8	326	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.55e-38	40	292	27	281	beta-hexosaminidase; Provisional
cd02808	GltS_FMN	0.007	265	328	302	361	Glutamate synthase (GltS) FMN-binding domain. GltS is a complex iron-sulfur flavoprotein that catalyzes the reductive synthesis of L-glutamate from 2-oxoglutarate and L-glutamine via intramolecular channelling of ammonia, a reaction in the plant, yeast and bacterial pathway for ammonia assimilation. It is a multifunctional enzyme that functions through three distinct active centers, carrying out L-glutamine hydrolysis, conversion of 2-oxoglutarate into L-glutamate, and electron uptake from an electron donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM23516.1	1.53e-128	1	512	1	523
AAQ01678.1	1.53e-128	1	512	1	523
ABY91501.1	2.53e-128	7	512	1	517
ADH60057.1	6.88e-127	1	512	1	523
AEM77732.1	5.99e-125	3	512	2	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	6.68e-74	7	512	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	3.29e-62	8	512	8	524	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	6.04e-59	4	512	39	614	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.01e-58	4	512	13	588	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.40e-58	4	512	43	618	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	3.31e-58	4	512	39	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.42e-41	30	329	55	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q6LJ30	2.89e-35	31	306	18	289	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1
P44955	2.84e-34	42	304	29	292	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1
Q0A911	1.70e-32	17	292	6	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001928_00738.