CAZyme Information: MGYG000001928_00945

Basic Information

• Species: UMGS75 sp900752975
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UMGS75; UMGS75 sp900752975
• CAZyme ID: MGYG000001928_00945
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
897	MGYG000001928_29|CGC1	103007.92	4.634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001928	1595171	MAG	Denmark	Europe

• Gene Location: Start: 7903; End: 10596 Strand: +

Full Sequence      

MKKYILVWLAVLFLMVGCNNLVQPEYKLILNLNDGSDNPKIIQKFDEPQDVDLFIPTREG
YEFEGWAYKDTIIYDSSIYVNRVITLKAKWNPKKYTVTLIDELNGYREQIIINNGDALNL
TPRECLGYKFLGWYKDDELIESGSFDYFEDITLNAKYEKEQYKATYYIDGEIYDEITISY
QDNWVHPKANKPGYRFLGWYYNDSKINTEKYIYNIDIQLTAKFEQETYIINFIDGNKEVL
TPIYVKYLEYLKLPTITKFGYKFLGWYDGEQKIDDGKYQGTYSMTLYAKWAPNTYYIKFM
SDGLEALDPLEVKYNEKFNLPTITKSGYTFLGWCYDGDLLEDGKYTYTHDITVTASWKSG
ITKNFLGTINITLFNMERNPYNEVSMYDSTTTIMASLYWHKYGIIKENDCYKVSFIGSPS
ERLQELGKFDYIILAFNDYPEYNSFVNIGLNVGDIIEFSQDPSQLEKGEVNVSVSCYNTI
YPDPDKAEFVDYLSGLYGNYTYVNSDIDLVQSYRGYKITWKTSNKNVINTNGEYTRPVVS
RKVTLTAVINNKDVYSFEVDVDGDKNKSEALTTGYFYTRFPDTTEETFQNLDIAYISFAY
VNSSGEFINMSESSSFIKNILANIVPKARKAGTKIIISINQDANQFSTIAGSESLRKTFA
TNIVKMLNKYGFDGVDIDWETPKSSEATNFTLMMKEIYHAVKANNLNHLVTAAIGGGKWQ
PPRYDLSNSTKYLDYINLMTYSMVSNGGKFHNALYKSSKGYTLSSCSIEESIEIYDSYNV
PRNKILVGLAFYGIKQTGSKGVGTSCSSSSSYTYRGIYQDYLSNPREGVEICFDEETASP
YIYDALNEVFISYENELSIAAKCDYVNTLGLAGVMYWQDGHDNGDTLLDAIKLNIRK

Enzyme Prediction     

No EC number prediction in MGYG000001928_00945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	585	885	2.1e-55	0.8648648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	1.64e-50	627	877	79	317	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	6.37e-49	574	882	4	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	3.29e-47	589	877	21	302	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	2.10e-38	627	877	65	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	2.57e-36	627	891	121	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUD63190.1	7.80e-89	329	897	96	735
VEU83132.1	3.32e-85	295	897	39	726
BCR35892.1	5.86e-85	396	897	159	724
AUD65244.1	1.62e-83	336	897	89	742
SQH57468.1	1.34e-80	502	897	242	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	3.82e-34	571	891	6	338	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5GZU_A	1.22e-30	627	891	104	391	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.66e-30	627	891	355	642	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6EPB_A	2.94e-30	627	882	114	383	Structureof Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
1D2K_A	4.34e-30	646	882	102	348	ChainA, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48827	1.61e-29	627	882	114	383	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
C5P230	4.17e-29	646	882	137	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
Q1E3R8	4.17e-29	646	882	137	383	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
P0CB51	4.17e-29	646	882	137	383	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
E9QRF2	8.25e-29	627	891	122	400	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	24