CAZyme Information: MGYG000001929_00791

Basic Information

• Species: Paramuribaculum sp900752995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900752995
• CAZyme ID: MGYG000001929_00791
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		63092.26	7.3906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001929	2523600	MAG	Denmark	Europe

• Gene Location: Start: 31568; End: 33268 Strand: -

Full Sequence      

MKRLTLLALLPGLLSGAAAAKHVPSTLDSVWAPVKVATPPSDAYIGLSMLENGEIRYYNY
GEQAVPGSVYLSSADSGLTWRTVKYGRDMPYGDRRSPVSGEYIRLTNMGKPGVYCIRTKG
GIDGDRTVTKVSDLPSIMIKPPVFIRDGKRIVVAAHGGTNPKGCYTYVSDDDGLTWKRSN
TVTSPDHKGGGFHQGIRWNHGAVEPTVIELNDGRLWMIMRTSQDRHYEAFSTDGGLTWSE
SQPSRFYGTITMPTLGRLADGRLIFFWCNTTPLPEMATANGVWDDVFTNRDVTHVAISDD
DGKTWTGFRELNLDPLRNTSDYALNGKGIDRGMHQAQFVEVAPGKILASIGQHPLHRAMM
LFDADWLYEKERSDDFTDSLANWTTFNYLKGIKGHCSYNRIDGVALEPHPDKAGKNVLHL
RYEPDDRLVSDVRGAVWNFPAMKRGAFTASVRIPEGSENVELVLNDRWFNPSDSVSCHES
MYRLPLDRKQLGIKDDAWHNVTVEWNLDSPKDKSARVRVDGKLRRQRLPLQNASLDGISY
VHFIALPAPATSQGIYVEEVRAKAAE

Enzyme Prediction     

No EC number prediction in MGYG000001929_00791.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	145	307	8.9e-21	0.40350877192982454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.04e-24	54	315	32	303	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.33e-16	141	305	115	251	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.12e-09	169	350	52	216	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.40e-05	149	306	1	151	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	9.07e-05	158	306	71	199	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO27937.1	0.0	1	564	1	563
AUI49199.1	0.0	1	564	1	563
QCQ52211.1	0.0	1	564	1	563
QCQ56765.1	0.0	1	564	1	563
QCQ47658.1	0.0	1	564	1	563

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004047	0.928538	0.065819	0.000907	0.000349	0.000290

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001929_00791.