CAZyme Information: MGYG000001929_00857

Basic Information

• Species: Paramuribaculum sp900752995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900752995
• CAZyme ID: MGYG000001929_00857
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000001929_7|CGC1	38083.02	8.0538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001929	2523600	MAG	Denmark	Europe

• Gene Location: Start: 16940; End: 17965 Strand: +

Full Sequence      

MRLCHISKNYKRMTSAGAIARRDIETILENLGSENIGLRRSFIHNGILHGLRQFIGFAKA
RMSVKEGDIIVLQYPMTEAFSVIARTAHRRGAKVIGVVHDLFGARELTMKPEDECRVLNL
CDVLLIHNDAMRRWLTGHGCDTKMVDYEIMDYLGGPGKMSARPLKGSPSLYFIGNADSRV
NGYLYDLAAYMPETEIYVYGPNFDSERAMATPNLKTMGVVKDTEIMATHKGDIGISWYGE
SLDGPEGQFGEYMAINNPHKVGLYMRCGTPVIVWKGAGRAKFIEENSVGLSVSSLRELPD
LLKMMTPEDYYAMTANVKTISERLASGHYLRKAIDQALTLL

Enzyme Prediction     

No EC number prediction in MGYG000001929_00857.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	12	337	5.7e-82	0.9751552795031055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	7.08e-69	1	341	1	333	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43054.1	2.52e-121	6	338	7	339
QQT78203.1	5.14e-76	3	337	2	335
QUU07104.1	5.14e-76	3	337	2	335
QRP56553.1	5.14e-76	3	337	2	335
ASM65269.1	5.14e-76	3	337	2	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	2.88e-09	1	338	3	326	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.97e-09	1	338	11	334	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	8.81e-32	9	338	8	324	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	1.36e-21	19	338	19	330	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
B3XPQ7	3.53e-10	192	338	190	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	2.12e-09	192	338	195	334	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B5A7L9	1.56e-08	1	338	1	324	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001929_00857.