CAZyme Information: MGYG000001929_01172

Basic Information

• Species: Paramuribaculum sp900752995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900752995
• CAZyme ID: MGYG000001929_01172
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000001929_11|CGC2	40797.11	9.464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001929	2523600	MAG	Denmark	Europe

• Gene Location: Start: 37496; End: 38575 Strand: +

Full Sequence      

MKRICFLFNHFQFQDGVCRSAIAMANLLAYRNDVEVTLMSIYKFEKETKRYLNPKVKTTN
IFGFYFRGFSKFVEKLPHSLIYKRFVKDCFDIEIAFQYGTSYKILTSVDKPSKVKRIGWI
HGYDMTFKHYYLKMDQMVSVSKGGAIMAHHDLNGNVPVSYCYNPIDNDKVVRQGAESIPI
KRINGGIQLITVGRLSPEKGYDRLISIVKRLKDDGYFFSLWIIGNGPEREKLSSHIKESG
LTDTVTLLGAQTNPHSYTSKADAFICSSFSEGYSTACTEAIMLGIPVITTKVGGAKEIIE
DSQCGILTETDDAALYHGIKKVLDNPTLIAEWKESLKTTKKRFSTNNRFQQLKNILQLD

Enzyme Prediction     

No EC number prediction in MGYG000001929_01172.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	189	332	4.4e-33	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	6.44e-63	3	345	1	347	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	1.07e-41	3	357	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03820	GT4_AmsD-like	1.21e-38	3	351	1	348	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
COG0438	RfaB	1.22e-38	1	357	1	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	5.93e-34	185	334	1	153	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC26799.1	8.03e-109	1	358	1	362
BAM94611.1	1.84e-107	1	358	1	359
QSQ90296.1	1.84e-107	1	358	1	359
AXT59949.1	1.45e-61	35	355	55	380
AII62863.1	7.40e-58	76	344	88	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC1_A	6.54e-14	164	326	299	464	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC1_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC3_A	6.54e-14	164	326	299	464	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC3_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC7_A	1.17e-13	164	326	298	463	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC7_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFO_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
5D00_A	3.83e-10	98	312	97	326	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
6KIH_A	6.10e-09	189	326	247	390	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C7	3.11e-20	131	343	142	350	N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglJ PE=1 SV=1
Q9R9N0	2.14e-15	189	328	171	307	Lipopolysaccharide core biosynthesis glycosyltransferase LpsD OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsD PE=3 SV=1
Q65CC1	6.41e-12	165	326	179	348	2-deoxystreptamine glucosyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanF PE=1 SV=1
P71243	1.65e-11	121	313	151	357	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) OX=83333 GN=wcaL PE=3 SV=2
Q4H4F8	2.13e-10	189	328	208	350	2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Niallia circulans OX=1397 GN=btrM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000005	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001929_01172.