CAZyme Information: MGYG000001929_01635

Basic Information

• Species: Paramuribaculum sp900752995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900752995
• CAZyme ID: MGYG000001929_01635
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743	MGYG000001929_20|CGC1	83813.64	6.0035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001929	2523600	MAG	Denmark	Europe

• Gene Location: Start: 6859; End: 9090 Strand: -

Full Sequence      

MKLQSFILPALFALALPLQAQQVQISPVPQNIVWGQKAFDKPAAVKLKGASTADADAVAA
LTHVIPAGKGVKVTIGEKGDKAVASVASKIPSKPEGYYLKVTPKEVIIAGNDANGTYYGV
QTFLQIASQPEVMSVEITDWPSTPNRGVVEGFYGNAWSFDDRLSQYEFYGRNKMNTYIYG
PKDDPYHRGKWRELYPADKAAEMKALNEAAKRHKVNFVWGIHPAGDHRWNEEDNQATIRK
FEQMYDLGFRNFSIFFDDVFGAQADGKKHAEYMNYVKKNFVDKHPDIENFIMCPALYNKA
WKGSFQPSYLEDISVMDPSIKVMWTGNSVVDMINVQDMEWINPKIGRKAFIWLNYPVTDY
CINHLLMGPFTGNDAEATSMVSGFTANPMEYAEASKLSLFSNADFLWNPDKYDADRSWEL
ALERLMPAHRDAFREFCLYNVDLGQNTHRLRRFNESPALKALIDKYEPAMTESYMAGAAK
ELSDEFANLEKSSAELLSVADTNAMLKEIKPWIEVSEMLGKRGQLVAAMYGDIFSGNAKG
FVDNYVAYAALTDKASKVASRDFPGSIKVAYPMVGSLYAEPFLKRSVNRMVDYYRHNNDY
RLDVFPQLALENGNYRIRLNGQWLGNPKAGTTGGRPVWQAAEDDVNPDRQIWRVTYDPET
ARYSIVNAKDGRYINENGSFTVNPDSNPFDAQWHTFIIERDGDRYVIRNGGNAGNSFWKS
DAEGISKASKPEEKAEFEFIPVK

Enzyme Prediction     

No EC number prediction in MGYG000001929_01635.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	146	437	3e-102	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.13e-148	146	436	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	2.69e-14	24	139	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam14200	RicinB_lectin_2	0.004	648	709	1	66	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13183.1	7.73e-247	20	742	22	735
QUB43766.1	2.93e-175	72	741	70	736
AUI48059.1	1.13e-149	6	604	7	610
QTO26212.1	3.17e-149	6	604	7	610
QRM68690.1	4.47e-149	6	604	7	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	3.22e-146	6	604	7	607	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	1.06e-145	20	604	3	589	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J47_A	1.37e-145	21	604	1	586	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2CHO_A	1.37e-145	21	604	1	586	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	1.79e-145	6	604	7	607	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.77e-145	6	604	7	607	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	1.77e-92	25	588	46	618	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	3.40e-92	25	588	46	618	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	2.31e-48	63	493	93	557	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q2CEE3	5.45e-35	147	433	4	299	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000208	0.999159	0.000171	0.000170	0.000153	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001929_01635.