CAZyme Information: MGYG000001929_02141

Basic Information

• Species: Paramuribaculum sp900752995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900752995
• CAZyme ID: MGYG000001929_02141
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		41663.52	9.6362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001929	2523600	MAG	Denmark	Europe

• Gene Location: Start: 14721; End: 15848 Strand: -

Full Sequence      

MHYFLSVGEPSGDLHASVLIDELKRKDAEATFTFLGGDLMARAVGHAPVIHYSRMAFMGF
SEVLRNLKTIGENFKMAKASLKGSGADAMILVDYPSFNMKLAKYAKELGIPVFYYISPKV
WAWKEWRVKGLRRYVDHILSILPFEVEYFKDKNVRVTYVGNPSKEEMELKLAHAGTKADF
IARHSLDPDRQLLALVPGSRRGEIRNNLPIMDAVARRNPSLQPVIAAAPGIPPEFYARYS
SFPRIEGDTFRLMHFSEAALVTSGTATLECAIAGTPQVVCYRANGSKLSYNIMKHLIKAP
FVSLPNLIADREVIPEMLVHLCTVDSVDAKLKAILEGMPGREKQLEGYRIMMSRLGEGKA
ASGAAAIITKELNSR

Enzyme Prediction     

No EC number prediction in MGYG000001929_02141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	2.1e-105	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	7.92e-107	4	373	5	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.25e-106	1	369	2	373	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.61e-84	4	368	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.50e-64	5	368	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.28e-56	1	326	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	6.79e-147	1	374	1	376
QQR08529.1	9.35e-146	1	375	1	377
ASB37800.1	9.35e-146	1	375	1	377
ANU64105.1	9.35e-146	1	375	1	377
QCP71596.1	2.34e-137	1	373	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.58e-35	5	335	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.58e-35	5	335	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.57e-63	8	372	12	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	3.45e-63	4	370	8	384	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q39T49	1.25e-62	8	375	14	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	1.49e-60	8	375	14	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q6ALW0	1.86e-58	8	365	17	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001929_02141.