CAZyme Information: MGYG000001929_02227

Basic Information

• Species: Paramuribaculum sp900752995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900752995
• CAZyme ID: MGYG000001929_02227
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		82982.75	6.6197

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001929	2523600	MAG	Denmark	Europe

• Gene Location: Start: 357; End: 2597 Strand: +

Full Sequence      

MNQNRFHSCKKMLRAAAAAAILGCLASTSPAFAAKPTIVPVPMSIVEQQGSFKITPSTAI
VYGKGLKPQADILRNRLWCASGMDLRTSQGTKSQQNILLAVDPKKVKEAEGYILSVTPKG
ITVTGHDAGGVFYGIQSLLQLMPAEIYSKSPVRGVDWSVPAVTVTDAPARPWRGMMLDVA
RYFYDKEFVKKYIDMMATYKLNKLQLHLIDDSGWRLEIKKYPRLTEVGAWAGPDTKRLGG
YYTQDDIREMLDYAAARNVEIIPEIEFPAHILSAVVAYPWLSCTGEQHEMPLQHFISRDL
LCAGKQSSIDFLEDVLNETVELFPSKYINIGGDEAVYVRYENCPDCQALMKKLGLTKASE
LQGYLTNVVADMMAKKGRTVVGWEEIIQRGKVTQPVAALIWHNVADSIQATEGGHKAILT
PATHMYLDFPESSTPGEVKSATWMPPISLEKCYSMPVNDYSDKSTVLGVQGSFWSDQFIH
GTVLQEIPNINENRSESYAEYLNFPRMLAVSEVAWAPESKRDYKDFLNRVSTHYPRLDYM
ECSYRVPEPIIEKMTDLPGGGVEFTLSPSVEGSQIRYTTDGSYPNVHSAVYTGPVKVNNK
DDFRAITVVTPTHYSLPIYFAPDYSAYAQFGKFSGEWKPLQIQSDRMGTVRFDVTGKVGG
NGTYEFTFIPTRGSNAIELGAIKLLKRDELLDQTDSAVETVKIGGHRTYKLTVNSFEAGT
PFYLDVQAKGNGGNDTQGLLFVRKLD

Enzyme Prediction     

No EC number prediction in MGYG000001929_02227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	171	517	8.1e-101	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	9.04e-156	171	530	2	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.39e-126	171	517	2	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.58e-117	38	597	136	691	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	4.28e-87	172	530	3	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06569	GH20_Sm-chitobiase-like	1.05e-73	166	525	1	426	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24557.1	0.0	10	746	5	738
AOM80831.1	6.14e-236	38	744	27	735
ARS41579.1	4.78e-221	34	744	20	730
ATP56474.1	2.11e-219	21	744	39	772
ALL05198.1	1.03e-218	25	745	15	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	4.44e-113	10	608	2	601	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7DUP_A	4.57e-85	38	530	6	506	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	2.44e-84	38	530	6	506	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
3RCN_A	3.73e-77	38	545	10	514	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
6EZR_A	8.89e-77	112	547	211	640	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	2.84e-104	38	596	37	586	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	4.78e-72	26	548	21	533	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	3.29e-65	96	511	196	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	1.44e-58	108	533	56	465	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	1.36e-50	38	609	200	845	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000397	0.996580	0.002343	0.000268	0.000208	0.000169

TMHMM  Annotations     

start	end
12	34