CAZyme Information: MGYG000001931_00081

Basic Information

• Species: CAG-279 sp900548875
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900548875
• CAZyme ID: MGYG000001931_00081
• CAZy Family: GT83
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	MGYG000001931_1|CGC2	65416.73	9.6253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001931	3207508	MAG	Denmark	Europe

• Gene Location: Start: 108626; End: 110356 Strand: +

Full Sequence      

MNINTSRKESSARQFGWLVFLLSALLTLPWIGMGNFYTRGEPREALVAVAMLEQGNFILP
FFQGEFAFKPPMLHWLVALFSLPQGYVSEMTARLPSALACIAMCCAFYSFVSRRFSPSRS
FYASLILMSCFEVHRAAMTCRVDMVLTMFVVLAFLALYRWYEKGYKGMPWLASLAISGAI
LTKGPIGAILPCFALFVFMLFYREKWSRIILSLVKVSVLSVIIPLVWYVAAYRQGGDVFI
RLVMEENFGRFLGKMSYESHEHSFLINFAMIASGMLPWSLLVVLGIVTAKWGKLKSGKKW
VKEQWQRFRAANPMIVFSVVAAVCVFVFYCIPASKRSVYLLPMYPFMSLLVANYMVDLYM
ERKKIVKIYAVFLAVVSLLYIALLYAVHFADLSILGTSRGTRRLIAQMTALQTTDIGFLY
IVLTLLPTIVAVAVLAGVRHWKNVLFGVAGLWMLVTLTLDGLLLPAIKNSVPDYQFAQSV
AMLQPEGNIYFYRPVGEKEEAIYTVGFYLGDRLVSSNEETAYPDEGVALFRETNRDRFLS
AMAEKGYRTEEKLRTLNEFTSIRCNILLYEFSKIKE

Enzyme Prediction     

No EC number prediction in MGYG000001931_00081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	478	2e-75	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.02e-30	17	459	11	427	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.36e-10	69	228	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	3.37e-07	41	390	33	375	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam10131	PTPS_related	4.79e-04	144	376	80	295	6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein. This domain is found in various bacterial hypothetical membrane proteins, as well as in tetratricopeptide TPR_2 repeat protein. The exact function of the domain has not, as yet, been established.
pfam02366	PMT	0.004	51	232	42	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ74247.1	4.93e-32	18	352	15	336
AWW30587.1	5.07e-28	18	389	14	369
AGA77175.1	2.40e-26	16	363	12	345
QII43704.1	3.08e-26	16	364	9	342
CAJ73913.1	1.08e-25	31	353	51	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.08e-11	16	350	32	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	3.28e-15	18	379	7	343	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	2.05e-14	18	385	11	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
O67601	2.02e-10	19	366	5	318	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A0KGY4	3.21e-08	18	364	10	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
C5BDQ8	1.29e-07	16	368	6	345	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000027	0.000002	0.000000	0.000000	0.000027

TMHMM  Annotations     

start	end
15	37
57	79
94	111
138	160
180	202
209	231
265	287
308	329
339	356
368	390
416	438
445	467