CAZyme Information: MGYG000001931_00948

Basic Information

• Species: CAG-279 sp900548875
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900548875
• CAZyme ID: MGYG000001931_00948
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		47652.33	5.687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001931	3207508	MAG	Denmark	Europe

• Gene Location: Start: 22964; End: 24193 Strand: +

Full Sequence      

MKILKIFALLTCMLGSFSSYASDFVTIDGKDLRTPDGKKLEIRGTNLGNWLNPEGYMFNF
KHAESAHFINEMFCQLVGPDAAAEFWKLYKDNYVTREDIAFIKKTGANTIRLPFHYKLFT
DEDYLGLTANQDGFARVDSVVNWCRENGLYLILDMHDAPGGQTGANIDDSYGYPWLFESE
KSQQQFCEIWKHIAERYCNEPVILGYELLNEPIPHYFPNKEELKAKLEPLYIRCTKAIRE
VDNNHIILLGGAEWNNSFEFFKDFDFDDKIMYTCHRYGGEPTAKYIDTFINFRDKTGKPM
YMGETGHNTIEWQQAFTKVMKENNIGYTYWPYKKLEKETCMAIKTPENWDLIVNFANADR
STYGKIREARPDQQLAWKAMMDFIENCKIKNCIPQKEYIESIGLTCPKK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	80	336	2.4e-100	0.9922178988326849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.55e-35	89	330	20	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.38e-18	42	259	18	236	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89172.1	9.66e-211	13	404	17	414
QDO68125.1	7.90e-210	24	404	34	414
ALJ59797.1	2.26e-209	13	404	17	414
QBJ18569.1	2.34e-209	24	404	35	415
BBK86559.1	4.72e-209	24	404	35	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.24e-34	85	352	20	335	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.13e-33	85	352	20	335	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	8.51e-16	102	332	42	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	5.14e-15	102	332	42	288	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]
3AZR_A	5.14e-15	102	332	42	288	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23340	8.69e-34	85	352	20	335	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	8.69e-34	85	352	20	335	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
W8QRE4	2.67e-32	24	283	3	256	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P0C2S3	8.38e-32	85	352	20	335	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	1.88e-19	91	325	28	286	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000312	0.998875	0.000234	0.000198	0.000188	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001931_00948.