CAZyme Information: MGYG000001931_01300

Basic Information

• Species: CAG-279 sp900548875
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900548875
• CAZyme ID: MGYG000001931_01300
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		40201.68	9.8632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001931	3207508	MAG	Denmark	Europe

• Gene Location: Start: 4083; End: 5150 Strand: +

Full Sequence      

MDKHPKYRNVLIARFSALGDVAMTVPVVYSACRAYPQTRFVMITQQVASSLFVNPPENLV
VIGVDVKVKYHGPKGLLKLFRELRADYDIDAFVDLHSVIRTHILSLYCRLWGVPVKRIRK
GRGVKRELTRRHHKQLHQLCSSRDRYFDVFRRFGFDFGEDFTSLFSAPVDQQLFANITPP
KNDGETWIAIAPFAKHIGKIYPTEKMAEVVTALAARPATRIFLFGGGGDEQLKLREWAQQ
HDNVISMAEKRYGFPKELALLSCVDAMVSMDSANMHLASLVQVPVVSVWGATHPFCGFTG
WKQSPDNAVQLDLDCRPCSVFGNKPCYRGDYRCLNGIAPEAIVRKVETVLKSKRR

Enzyme Prediction     

No EC number prediction in MGYG000001931_01300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	327	5.2e-35	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.24e-44	9	347	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.24e-41	8	354	2	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	3.29e-15	77	318	2	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.07e-11	1	311	1	306	lipopolysaccharide core biosynthesis protein; Provisional
cd20206	YbbR	3.20e-04	52	95	4	45	YbbR domain. YbbR domains occur as tandem repeats or in architectures together with other domains. Putative roles in cell growth, cell division, and/or virulence have been suggested for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD37124.1	6.29e-147	8	350	3	346
QQR08225.1	1.63e-137	8	351	10	353
ANU64408.1	1.63e-137	8	351	10	353
ASB37493.1	1.63e-137	8	351	10	353
AHF12543.1	1.18e-127	7	347	3	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	5.18e-11	19	311	5	294	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	2.38e-09	19	311	5	294	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q57336	4.43e-07	8	311	9	301	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997987	0.001908	0.000105	0.000003	0.000002	0.000005

TMHMM  Annotations     

start	end
10	32