CAZyme Information: MGYG000001931_02246

Basic Information

• Species: CAG-279 sp900548875
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900548875
• CAZyme ID: MGYG000001931_02246
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	MGYG000001931_49|CGC1	59859.2	5.3958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001931	3207508	MAG	Denmark	Europe

• Gene Location: Start: 6874; End: 8454 Strand: +

Full Sequence      

MNKILLAGAFTMLLGSGAFAQEKCTVTFDYADSRQEIHSFGASDCWRAQYVGMWPEDKKN
EIADLLFSSEFDESGSPKGIGLSLWRFNIGSGSHEAGEAGGIASDWRRTECFLDKDGNWD
WTKQEGQRWFLDAAKKRGVPYTLGFSITAPYFMTKNGMARASENTPYANIRDDQYRNYAA
FMAEVCDHLGLDYLSPINEPQWEWVVSRQEGMQATNGECARLIRLLDEEMEKRQSDTKIV
FGEAADIRYLYRAGTDKPMRDNQISEMFVPSGEHYIGDLKHVAKTVSGHSYWSTWPLDTL
ITTRSQLHKALPEGYSYWQTEYCPMEQNSDNPNGGGQRDFGMDYALYVSRIIHHDLTVAE
ASSWQSWTAFSEANYKDVMIYIGDETLIYPHKKLGTKFTDTGKTDGYFLPTKYMWALGNY
SFFVRPGMVRMAQENELSVNTVETARELMVSAYVDKNKKKMVFVFVNYGDTDRNVDLSVK
NLPKKMHLGSLKRYETSSRSDLKYTGFSEADAVYVPARSVVTVVTE

Enzyme Prediction     

No EC number prediction in MGYG000001931_02246.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	25	524	1.6e-178	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.32e-157	25	381	3	367	O-Glycosyl hydrolase family 30.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCW99529.1	7.60e-146	12	522	18	519
ACU06063.1	1.92e-144	4	524	14	534
AQS94807.1	2.15e-141	21	524	25	514
QUT88592.1	8.43e-141	26	526	39	538
ALJ60402.1	1.69e-140	26	526	39	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	3.34e-109	35	526	17	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7O0E_A	9.33e-08	25	524	4	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.30e-07	21	524	7	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	7.53e-08	21	524	24	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000405	0.998905	0.000193	0.000173	0.000165	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001931_02246.