CAZyme Information: MGYG000001931_02303

Basic Information

• Species: CAG-279 sp900548875
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900548875
• CAZyme ID: MGYG000001931_02303
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000001931_52|CGC1	40476.89	8.0349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001931	3207508	MAG	Denmark	Europe

• Gene Location: Start: 12067; End: 13149 Strand: +

Full Sequence      

MKFLFVVQGEGRGHLTQAISLGEMLRRHGHEVVEVLVGKCSNRELPASFVGKMPAEVKVF
HSPAIDYGRNGKKGKILKTIVANTTPKKLAKWRKSISFLLKRIDKTKPDVIVNFYEMLMG
AANFLHRIDVPIVSLGHQFLVGHPDFSHSVTSEHGQFALRLSNQICSYGSSLTLALSFYP
LPEFRRDRLVVVPPLLRSELFGLKPCDEGFVLGYMLNAGYMEEVEEWHAKNPQQRLHFFW
DRKNCEAVEKVDKTLTLHRISDSEFLSYMSRCSGYITTAGFESICEAMYLGKPVMLIPAH
LEQQINAADAHGIGAGIVAKSFDISLLMDFMGEYAADTERFHAWVNSAEQRIVALLESVS

Enzyme Prediction     

No EC number prediction in MGYG000001931_02303.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13528	Glyco_trans_1_3	7.26e-26	1	331	1	317	Glycosyl transferase family 1.
COG1819	YjiC	1.39e-13	1	320	2	349	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03785	GT28_MurG	4.06e-13	2	318	1	303	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03784	GT1_Gtf-like	1.88e-08	1	325	1	361	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
PRK00726	murG	0.009	1	114	2	98	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH41937.1	5.64e-130	1	359	1	361
AVV54514.1	5.64e-130	1	359	1	361
BAR48128.1	3.80e-128	1	359	15	374
BAR50670.1	9.95e-127	4	359	1	357
AEW22571.1	9.95e-127	4	359	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	6.92e-07	13	339	15	356	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	6.99e-07	13	339	15	356	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	3.83e-06	13	339	15	356	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001931_02303.