CAZyme Information: MGYG000001931_02317

Basic Information

• Species: CAG-279 sp900548875
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900548875
• CAZyme ID: MGYG000001931_02317
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1051	MGYG000001931_53|CGC1	117008.8	4.4906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001931	3207508	MAG	Denmark	Europe

• Gene Location: Start: 11379; End: 14534 Strand: +

Full Sequence      

MNKYLYSLVCFVAFLFAGMPLKAVNYGDYNLFAHFNFENDATDVMGNVQTTASNLSYEYD
ADLGMNVMKFNASNKGNLKLDTYPLAEQMTVSLWFNRQDVDASTNWRMILAWYALDGSCI
YLTPHTSWGTEAFLVSDNKQYSDYKSVRLADIALNKWVHIAIVFDGVNVLAYQDGKLMGT
AKFVGDVTTLNTVKHYFGNFPENNYTMTGKIGDIRIYHSALVENQIIALANKQDVPEPGV
VEDTDAPYAQISFDGEIADVKGHLTLDTNVECGKSVDMRNVGVFQSDSYIATSNDPIAKD
KYSVALLYRSEDFSENMGDKTILNFTAENGDYVKLLTRYVDGQLMLEAERSENGTVKKSG
VTPHALNPASWNSIVFCQTYNAAGTGACRIYVNGILSRTGMSFKTNNLDINRWEIGDENG
NALNGNYADVSFYHRELTPEDVAAYHGGNTNAIALSLYPDEEYQTIRNFGGSDGWTGQFV
GLYLSEQQREEIAELLFSKEYDENGNPKGIGLSSWRFNIGAGTSEQGDDSRISDETRRSE
CFLNPDKTTYNWDKQAGQQALLELAVKKYEVPDIIGWQNSPPVMFTKRGLGFREYGDPKA
TILKAEHYTDFGNFLADVIEHFAEKGIHFDYISPLNEPQFDWTCDATTRLAKQEGSPWSN
QEIHDVVTAINDVFVERGIDSKLFITESGNIQYHLSSSSGFATQQIDTFWGNGELNVKDL
PALANIVSSHSYWTDGSAAAIVDNRVALRDQLAAKNLGLEYWQTEYSLLGTGYQFGHPSG
QLSPIACAISLARIIHADLAIANATGWQWWTTFEMERNLSSEDRFSLIRVALNADKSGGV
YSTTKMMYGMGNFSFFIRPGMKRIELERSDAMDDYSSITNQMFSAYKDEATGRIVIVAIN
ASSNDSGISLPELPVGEGKVVKTYVPYITSGKDGDDLKRYDEVYAGQHYVMPGSSIITFV
GEPEEGSSVEMVIDNDNVLVYPNPAVDYVKVQSPAMIRHCSIFDLSGKLMQSLDVNNLEF
DVNISGLDKGIYLMRLDGEYGAVVKRIIVSK

Enzyme Prediction     

No EC number prediction in MGYG000001931_02317.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	455	960	1.4e-152	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.06e-110	452	812	1	355	O-Glycosyl hydrolase family 30.
pfam13385	Laminin_G_3	1.24e-15	89	226	19	150	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam18962	Por_Secre_tail	3.85e-13	980	1049	1	72	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
COG5520	XynC	1.45e-12	455	903	36	373	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
TIGR04183	Por_Secre_tail	6.98e-10	980	1049	1	71	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75064.1	2.45e-196	21	1048	18	1040
QEC74452.1	6.43e-114	437	960	18	523
QKJ28829.1	1.06e-112	455	960	30	516
QEC54450.1	2.82e-111	453	940	43	516
AMR33204.1	2.10e-110	453	962	25	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.61e-79	463	966	16	501	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	2.53e-11	455	960	25	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
6IUJ_A	2.80e-08	463	964	32	474	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
4FMV_A	3.00e-08	464	965	14	390	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
6KRL_A	3.16e-08	463	964	103	545	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000358	0.998804	0.000242	0.000198	0.000192	0.000176

TMHMM  Annotations     

start	end
5	27