CAZyme Information: MGYG000001932_00077

Basic Information

• Species: UMGS1975 sp900751745
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QAND01; UMGS1975; UMGS1975 sp900751745
• CAZyme ID: MGYG000001932_00077
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		64813.79	6.4544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001932	1804998	MAG	Denmark	Europe

• Gene Location: Start: 83146; End: 84864 Strand: +

Full Sequence      

MAKVQKAMRMALKGAKLMVTKGPRVTWQLVKEKKTQKQAYQQMATLHLISPEERARQKQA
QFKNPVVISVLTPLYNTPERFLTELIDSLQAQTYPNWELCLADASDDEHGYVGQICRERA
EKDPRIVYRHLEKNGGISRNTNACIQLASGAYFGLLDHDDVLHESALYEVMKAIDEQGAD
FIYTDEVKFDGDPAKANDFNFKPDFGKDELRVHNYICHFTCYSRALLETLEEAYRPAFDG
SQDHDIVLRLTERAQRIVHIPKVLYYWRLHGNSVSLNLGSKSYAVDAAIRAVKEQLERAG
EPGTVESNLPYLTNYRIRYEMGTPRISVLLYDAETKAQAQRCLEGLCAHMAYRPLEILCY
DQAAPQCDQEEITIKTIARQKTLGESLDAMAQAATGEMLALYSAFLTPEEPDWICEMAMF
AQRADICAVGGKCYDEKDNVLCAGVALDKDEEEKLKALCRGTHRDQQGFEAMLRYVRNVT
AVHPECMMIRRQTWQALGGFACAPAGYEAVDLCLRGEEKGLSNVWTPYSAHKRNGHGKQA
DKHIQEFAGKWSERLAHDDAYYNPNLKKLGLV

Enzyme Prediction     

No EC number prediction in MGYG000001932_00077.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	229	1.7e-24	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	7.33e-91	67	268	2	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	9.84e-25	69	227	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.70e-22	69	273	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	3.09e-20	70	184	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	6.11e-20	68	279	5	207	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO35980.1	7.01e-167	1	569	1	553
QBF76213.1	7.01e-167	1	569	1	553
QUC66692.1	5.82e-125	12	566	365	936
CAB1243278.1	8.90e-124	13	566	447	1023
QMW89744.1	2.97e-117	3	566	20	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.20e-12	64	180	3	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.28e-69	61	566	361	888	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	5.66e-45	55	566	308	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	3.95e-09	67	269	9	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P46918	7.80e-09	69	176	11	117	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1
O32268	1.17e-08	67	277	7	213	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001932_00077.