CAZyme Information: MGYG000001933_00428

Basic Information

• Species: Prevotella sp900544495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544495
• CAZyme ID: MGYG000001933_00428
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000001933_5|CGC1	35775.9	10.1239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001933	2797127	MAG	Denmark	Europe

• Gene Location: Start: 68581; End: 69510 Strand: +

Full Sequence      

MNILKKTACLLILCITIGSSAALAQMKWNSAYKAYVDQYKDLAIEQMLRYNIPASITLAQ
GLLESAAGRSDLTRAGNNHFGIKCHGWTGRRVYHDDDARGECFRAYDNARQSYEDHSRFL
ATQSRYARLFDYKRTDYRSWARGLKACGYATNPQYATKLIQIIELYNLSCYDRATSYDRF
MARHVSTDKPAPDGSLHVVKFYNKNYYVIAKTGDTFKELARETGISARKLARYNERNKKD
MLAQGDVVYLKKKQKRAEKQYRRTPHVVRAGESMYSIAQLYGIRLKSLYKMNHLQPDYQI
QVGDRLRVR

Enzyme Prediction     

No EC number prediction in MGYG000001933_00428.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	41	168	7e-34	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	1.00e-38	43	172	171	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	3.61e-34	3	177	10	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.20e-28	25	178	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.34e-26	40	168	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12711	flgJ	1.05e-18	28	162	223	354	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29226.1	1.29e-147	1	308	1	307
VEH15664.1	4.86e-147	4	308	1	305
QNT66218.1	1.18e-145	11	309	13	307
ALO49150.1	5.68e-141	5	308	3	304
BCS86660.1	7.29e-140	23	308	1	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.34e-12	33	163	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.61e-12	33	163	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.07e-11	33	163	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	1.06e-07	33	172	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	5.21e-15	54	309	202	473	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	5.14e-11	33	162	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
O32083	1.90e-10	49	172	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000378	0.998975	0.000204	0.000159	0.000145	0.000144

TMHMM  Annotations     

start	end
7	24