CAZyme Information: MGYG000001933_00878

Basic Information

• Species: Prevotella sp900544495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544495
• CAZyme ID: MGYG000001933_00878
• CAZy Family: GH77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		45803.25	6.5045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001933	2797127	MAG	Denmark	Europe

• Gene Location: Start: 37146; End: 38312 Strand: +

Full Sequence      

MLGDGCQWWVRRFRNMAKYFDAYRIDHVLGFFRIWDIPADCVHALLGQFSPALPMTKAEI
GSYGFEFDEERHTRPFINKWVLERIFGERADEVAQNYLQPVADDGTYSMRPEYDTERKVQ
AAFAGKDSAADTALRDGLYKLIENVLFVRDRKRNYLYHPRITAQLNFAFAALGDDDKQRF
NRLYDDYYYRRNSMFWYREAMKKLPRLVQATRMLVCAEDLGMVPESVDWVMKDLRILSLN
VQTMPKEYGVRFADLSKYPYRSVCLFSSHDMPTLRLWWDEDLEVAQDYYETVLYHTGAAP
HPLPGWLAREIVVRQMQTPSMLCIVQLQDWLATDERIRQADPTGERVNVPANPFHYWRYR
MPMTIESLKADRDFVNSIKDIVGETGRY

Enzyme Prediction     

No EC number prediction in MGYG000001933_00878.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	4	382	8.9e-59	0.45951417004048584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02950	PLN02950	1.92e-110	1	378	529	909	4-alpha-glucanotransferase
PLN03236	PLN03236	7.04e-88	1	387	342	741	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	3.39e-59	4	364	255	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	2.23e-24	183	381	316	512	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14510	PRK14510	2.66e-14	209	387	1066	1220	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28441.1	2.15e-183	1	387	506	891
VEH15003.1	9.76e-181	1	387	513	898
ALO49593.1	5.67e-180	1	387	513	898
BCS85622.1	2.20e-179	1	387	513	898
QNT66907.1	6.99e-179	1	387	505	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	2.19e-08	212	381	490	683	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	2.08e-07	212	381	490	683	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RXD9	3.72e-83	1	387	538	927	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q69Q02	6.40e-81	1	387	532	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
Q9PKU9	2.61e-09	204	370	349	515	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1
O34022	1.09e-08	204	381	349	526	4-alpha-glucanotransferase OS=Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC) OX=227941 GN=malQ PE=3 SV=1
P15977	1.20e-07	212	381	490	683	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001933_00878.