CAZyme Information: MGYG000001933_01315

Basic Information

• Species: Prevotella sp900544495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544495
• CAZyme ID: MGYG000001933_01315
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		29795.72	7.0773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001933	2797127	MAG	Denmark	Europe

• Gene Location: Start: 35876; End: 36655 Strand: -

Full Sequence      

MKILTTLIALALSVASFASTPHKYRLVWQDHFNGKTFDSCSWTKIPRSASADWKRYMSSA
DSLYAVRDGKLILRGAVNTNHEADTAQFVTGGLYTKHKRTVKYGKVEVRAKLGSAQGAWP
AIWMMPDEDIQWPHGGEIDIMEHLNHDNIAYQTIHTNYTYNLKLQDTPPHGKTHSIDRDG
YNTYSVELLPDSIVFSVNGDRYFAYPRIQTDKEGQFPFNRPFYLLIDMQIEGSWVGKADH
KQLPVEMEIDWVKFYELKE

Enzyme Prediction     

No EC number prediction in MGYG000001933_01315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	28	255	1.4e-56	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.84e-72	28	255	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	8.73e-29	30	255	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	1.06e-22	9	256	23	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd08024	GH16_CCF	3.81e-22	26	227	1	271	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
pfam00722	Glyco_hydro_16	3.59e-18	98	253	28	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25177.1	3.84e-113	2	258	5	259
QCQ43864.1	9.17e-103	20	258	26	263
QRM68917.1	9.17e-103	20	258	26	263
QLK81163.1	9.17e-103	20	258	26	263
QKH86000.1	1.51e-101	23	258	29	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	9.54e-97	20	258	26	264	ChainAAA, Beta-glycosidase [Bacteroides caccae]
5WUT_A	2.42e-30	25	256	6	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
6XOF_A	2.01e-29	21	256	21	267	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.08e-28	21	256	21	267	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
3ILN_A	1.43e-28	21	255	3	247	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	9.83e-45	12	257	46	289	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	1.57e-28	21	255	38	282	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	1.08e-27	26	255	425	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	3.38e-21	1	256	1	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9Z3Q2	7.54e-12	64	257	276	459	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999146	0.000158	0.000155	0.000138	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001933_01315.