CAZyme Information: MGYG000001934_01318

Basic Information

• Species: UMGS1002 sp900547565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1002; UMGS1002 sp900547565
• CAZyme ID: MGYG000001934_01318
• CAZy Family: CE2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		57376.66	4.7321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001934	2085116	MAG	Denmark	Europe

• Gene Location: Start: 1961; End: 3544 Strand: -

Full Sequence      

MKRLICLMLALVMLTVLMISCNNQTDTPEDTTTASSSNVPLDTTTAAETTTAVLDIVFGR
NGEKSDYVVIRPEKCGQKLIETAAELFRAINAVTGVSGSIKDDWYRNESEIAPHEILIGA
TNRPESSKYTDTLKANDWIITVENEKIIINGGSETATINAVRYFMENYVAGKTDTLSLPG
NTDYHYVSKLDTINVLDVKDKLKIIGRYSEVKDGITCDWTASGIEFTADCEGEVIVGLTS
AKSASGSGYDGDSYFTVYVDGIRQQERLEAKVGECQLTIASGLTKGVHTFRLLKQSHVAH
SNTVISTISLNGTIGDRPADNKIYLEFYGDSITCGYGLASESVKTIAGLANNDAYYCDGT
QTYAFLTAEALGADYSMVSVSGWRLAGTSASIPNTCYPFINWNRSGLRYDFTARVPDAVV
INLGTNDYSGSVGDQVFAQDMETWIKRIRKDYGNDSLPVVFVVNSMNDGYQNVIKVKLEE
MGGESAGLYMLKTVLNRGGLSNHPTCAGQKKTGELLTKLLQEKVLAN

Enzyme Prediction     

No EC number prediction in MGYG000001934_01318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	325	518	1.1e-30	0.9808612440191388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	3.45e-23	324	521	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam13472	Lipase_GDSL_2	1.48e-07	327	454	1	100	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
pfam17996	CE2_N	2.07e-07	213	305	11	93	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd00229	SGNH_hydrolase	6.67e-06	327	481	3	131	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01825	SGNH_hydrolase_peri1	3.26e-05	369	520	21	185	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADC90443.1	2.41e-29	201	522	56	388
QEY11545.1	4.10e-25	200	521	42	355
QQZ63923.1	1.13e-23	291	522	100	352
CQR54111.1	2.82e-23	202	522	15	352
AQT61115.1	1.41e-22	200	471	44	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	5.22e-18	213	452	23	251	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	1.27e-17	213	452	23	251	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	6.57e-17	277	520	64	323	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
2W9X_A	4.34e-09	322	523	142	356	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
3U37_A	2.07e-08	325	427	168	278	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	1.52e-16	213	452	504	732	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	2.32e-08	322	523	142	356	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001934_01318.